1BƎI# 0(_qȾ`a輨M/".pN 40 ';yaٸ Hi?(;CZᗘv/ ܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8`
#l8~
I` 5s ܱGLV>#d8^FB
kzOdEA^\#>];Cוr~m| llq`9spvE#@%]=G`6K DʐPQHX_0.r|
],*IPڈ' WyoIR}rY}@EE]t>OuVi#A.`'
v䶔etyvwvNHam❄/}4 ȖH0b
\8D=`nm`T:IW'H+ 8 $hE%;`
E}(/P4b +md+ 10Z RXAB휤1\2>F63S 57 ާ{sJO{dWQC~(zc _5y Cdd c$ J(_OC @ " 07O - ${MQgqL-_d_ !S >^'Ҹ_Bar%΄q=Ko&;~Ԅ T~DmLl&I߮63P?~w a8rPP.wW OgF3T i 1 M5=\f][̩ooF"/9F}mCOC!N ? (X&Hn>ptw|-
%y 껁(;#iޭ8t߇b! @ 7{ @YVOv/@U{ MV3i5W#'ȰVÑke ^anu2Uw?[-;%m;$ cf8(
2T2 bZg,uzT1w&16o FjHVZyjLRC~/v
t,߷t*M . k|AT嶠5!=B, |&aeR1%i
&c1\!^
rIyٍ
1p>d >Ӷ È0lrq n/ބkD؋V9ñ/ʴ1x(o}2X~ $ŗ {s a0-!!))*\e0,Ъ?\Ԟ, T
͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/ sgD)k)I/fgni~/%p ^QS$jlD!>Yye) CA9y+WMN҂z) Gl ыiWw@~˳PM
xQ VA$ VWUnaX
$K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(B DHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |c D_sVjprn] `yE`۩11\"NB \rr,%@N2N/@g#\xnu"xMkXnD O?H {wv#uV_F*+ (=8 6RJf;tQZר խly ueXJh&pSF\l(vk07h)҅6*$gk %h uUD,eI 40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6 oJ8 @CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ] 5UkLD5$bI/T81q(TH9)[ u/@3+gf-V*o` ( 'Md) P,2\K6ޠ_AP! NhÁ\y CMIP8CA< ?f϶&` ued$ zHܩóf(` ߨ5m w 5 k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB
ntgr9X7EXVn0!$E)^18FXJNFFPx)C_$; ,NmdTJ Oëoxnn<UV6;]a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\] 3vzҰyBq3j'`CP=Ăm+NvH%6f(NAa
=IϺ߶_撮d:枨 +}?p P+ObZjyb.H@@Z,Қ"-E4S ֙)nIlo IrB~>Vofbl qTL+*)9ܰXRVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2 ]K&ǟ/<~~^O?v)f= o Eӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTy GawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6pyǔqoKK0
ڽ5dw$ ,ϰ/
t*B v-:7ޚޱ
,p) @$:7ϴNy ]H
1hZfB1?ru3
BQ\}mc@!d
SW z13]oCqF8"ΔԸGi[bUfg N [GLoĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G ~'ͤ![<z8BOv5`9'5ɯ{6 g {qp-^3TIZd,=
p4wB&Ob$ҿF%dN>7`xͥE{_ v" 1.{$%r_m
LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $9g;?q0T;2dB̰E}JBp}
W[z?Z MΤ(y043w;S7x倳Nhȳ~
9|*OC/} "6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs[d1~OPa`{ I8,v%ѷ%$K vGX
YѤf
0nN&Qd #
Ph & @ t J ` F } x 3 / + ' # 3 / + ' # A ABE ACE ACT AD ADA ADD AGO AID AIM AIR ALL ALP AM AMY AN ANA AND ANN ANT ANY APE APS APT ARC ARE ARK ARM ART AS ASH ASK AT ATE AUG AUK AVE AWE AWK AWL AWN AX AYE BAD BAG BAH BAM BAN BAR BAT BAY BE BED BEE BEG BEN BET BEY BIB BID BIG BIN BIT BOB BOG BON BOO BOP BOW BOY BUB BUD BUG BUM BUN BUS BUT BUY BY BYE CAB CAL CAM CAN CAP CAR CAT CAW COD COG COL CON COO COP COT COW COY CRY CUB CUE CUP CUR CUT DAB DAD DAM DAN DAR DAY DEE DEL DEN DES DEW DID DIE DIG DIN DIP DO DOE DOG DON DOT DOW DRY DUB DUD DUE DUG DUN EAR EAT ED EEL EGG EGO ELI ELK ELM ELY EM END EST ETC EVA EVE EWE EYE FAD FAN FAR FAT FAY FED FEE FEW FIB FIG FIN FIR FIT FLO FLY FOE FOG FOR FRY FUM FUN FUR GAB GAD GAG GAL GAM GAP GAS GAY GEE GEL GEM GET GIG GIL GIN GO GOT GUM GUN GUS GUT GUY GYM GYP HA HAD HAL HAM HAN HAP HAS HAT HAW HAY HE HEM HEN HER HEW HEY HI HID HIM HIP HIS HIT HO HOB HOC HOE HOG HOP HOT HOW HUB HUE HUG HUH HUM HUT I ICY IDA IF IKE ILL INK INN IO ION IQ IRA IRE IRK IS IT ITS IVY JAB JAG JAM JAN JAR JAW JAY JET JIG JIM JO JOB JOE JOG JOT JOY JUG JUT KAY KEG KEN KEY KID KIM KIN KIT LA LAB LAC LAD LAG LAM LAP LAW LAY LEA LED LEE LEG LEN LEO LET LEW LID LIE LIN LIP LIT LO LOB LOG LOP LOS LOT LOU LOW LOY LUG LYE MA MAC MAD MAE MAN MAO MAP MAT MAW MAY ME MEG MEL MEN MET MEW MID MIN MIT MOB MOD MOE MOO MOP MOS MOT MOW MUD MUG MUM MY NAB NAG NAN NAP NAT NAY NE NED NEE NET NEW NIB NIL NIP NIT NO NOB NOD NON NOR NOT NOV NOW NU NUN NUT O OAF OAK OAR OAT ODD ODE OF OFF OFT OH OIL OK OLD ON ONE OR ORB ORE ORR OS OTT OUR OUT OVA OW OWE OWL OWN OX PA PAD PAL PAM PAN PAP PAR PAT PAW PAY PEA PEG PEN PEP PER PET PEW PHI PI PIE PIN PIT PLY PO POD POE POP POT POW PRO PRY PUB PUG PUN PUP PUT QUO RAG RAM RAN RAP RAT RAW RAY REB RED REP RET RIB RID RIG RIM RIO RIP ROB ROD ROE RON ROT ROW ROY RUB RUE RUG RUM RUN RYE SAC SAD SAG SAL SAM SAN SAP SAT SAW SAY SEA SEC SEE SEN SET SEW SHE SHY SIN SIP SIR SIS SIT SKI SKY SLY SO SOB SOD SON SOP SOW SOY SPA SPY SUB SUD SUE SUM SUN SUP TAB TAD TAG TAN TAP TAR TEA TED TEE TEN THE THY TIC TIE TIM TIN TIP TO TOE TOG TOM TON TOO TOP TOW TOY TRY TUB TUG TUM TUN TWO UN UP US USE VAN VAT VET VIE WAD WAG WAR WAS WAY WE WEB WED WEE WET WHO WHY WIN WIT WOK WON WOO WOW WRY WU YAM YAP YAW YE YEA YES YET YOU ABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE ?
ڔ ڔ ڔ ۠ ڔ ڔ ڔ ڔ ڔ ڔ ڔ ڔ ڔ . ܴ ڔ ڔ ڔ ڔ ڔ ' " ' '
'
D 9 4 , ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ C
D <
H 6
L
WT
W8
W
W
X
X ,
W
XL
W
W
X$
X\
W4 ,
X v
X@ l
W@ b \ Z
Wd Q
X4 d F
X8 , ;
X< , 2
X0
W\
Wh
Wt
Wl
WL
W
W
XD |
W
W
W
W
W
W w
Wp d
W`
WH Y
W O
W d C
X` ;
WD 5
W . (
W
W<
W$
W
W
W|
XH
W :
W
W
W
W
W
W d
W
W( n
X |
WX o
W a
X( T
Wx F
W H
Xd <
X -
X #
W
WP
XP
XT
XX
W l
X
W
W
W
W l
W l b , K c , k d , , , , x , x , F , h , E ,v . m ,k ,\ ,H ,9 ,& , , , + p q + r + L + + s + S + H N v + V A + a B + C +} +l P Z D +b +Z e +F X +6 +* g + + + G * I * i * l * * * n * O * o * Y * * Q | R * T t *v U *l Y *c w 11 ;( < >
?$ 1- @ @ A F$ P 2 2 2 2 2 7 7 7 9 P 9 9 :; :( : :
9 = ># >A 0 0 0 0 0 0 ? @ K P K ` K p K K Kr Ka KK K7 K& K K J J J 0 J @ J P J ` J p J Ju Jj J^ JR JE J7 J- J# J I I I I I I 0 I @ I{
P Iq P Ic ` IZ p I= I( I H H H H H H Ht H_ HI 0 H2 H( @ H P H ` G p G G G G~ G` GM G8 G' G
p F
F
F
F
F
F
` Fu
Fh
0 FR ` F7 p F
@ F
P E
` E E
E
E E
E{
Ec P EQ
E9
E
D
D
D
D D Ds DT 0 D5 @ D$ P D
C ` C p C C C C
C Cz Cc CS C> C, C C C 0 B B 0 B
B @ B @ B B P B ` Bn p BU B< B) B A A A A A
A
At
Ak
0 AV
@ AH d _ ^ e ^ f ^ g ^ h ^ j ^n k ^\ l ^L m ^6 n ^& o ^ p ^ i ] ] q ] r ] s ] t ] u ] v ]q w ]a x ]P y ]9 z ]' { ] | ] } \ ~ \ \ \ \ \ \ \ \o \U \@ \) \ [ [ [ [ [ [z [b [D [/ [ U Z Z Z Z D Z Zp ZY ZC Z, Z Z V Y Y Y Y Y Y Y Y Yx Ya W YP Y< Y- Y Y X X X X X~ Xk XW XB X+ X W W W W W W Wv Wa WR WB W* W V V V V V V V V Vk VK V4 V& V U U U U U Us UQ U< U# U
T T T T T E T T Tf TM T2 T T S S S S Sr SR S2 S R R R R Rv RP R/ Q Q Q Q Qo QY Q> Q Q P P P P $ Px / PV 8 P; L P . P O O B O O O_ O7 O N N N N N Nc NB N N
M M M M M M M{ Mi MX M> M* M M L C L L L L L Ll LS L< L'
L L K
K _1 _
! ( _
! ! _
! ( _
! ! _~
@! ! _r @
! 8 8 _e
! A _Z
! @ @ sj t t* 0 0 ( D wj t t u u s> s s V r m 0 t u 666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ _ _ _ _ bJ ! bA ! b1 ( b% b ( b 8 8 a _ ! ( _ ! ! a ! ! _ ! ( a @! ! a ! ( 8 a ! 8 8 a
! A a ( 8 a 8 8 at
A a] ( 8 aJ 8 8 a6
A a P ( 8 a
P 8 8 ` P A ` 0 ( 8 ` 0 8 8 ` 0 A ` ` ` `{ ` !
8 `g a !
8 `S b !
8 8 `7 c P
8 8 `' d !
8 ` e P
8 _ f P } | x t $ V bX bS : F 0 0 H d V P 0 4 D bf 0 0 R B 0 0 $ 0 V h m 0 4 D b c c 0 0 H d V x X 0 4 D cr eN e? e/ e"
e d d d d d d
d df dJ d, d d d d! c" c# c$ c% c e e 0 e @ e~ P er ` em p ef e^ g
g f f f f f f f f f f
f f f f f ! f # fy ! fj " fD # f, f f e e e e % e l0123456789ABCDEF g x x . e~ r " * h h hx hs hi h_ hV hM hI hE h< h1 h) h h h h g g g g g e g g g g g g ( %F ( -z %F h h i, = j i > i i >j i i ?( i i ?j i i ? i~ iv ? ij if OJ O jC N j8 N j- N j O P RV S jb j j `b `2 d d ` _ _ sd !f xB w X xB w X - xB w X xB w0 X + y x p X < y y p X > y x p X y x^ p X , z x p X = z y p X ? z x p X ! z x^ p X t q θ ʈ ^ - t B q F @ d " { z X # { { X . { z X $ { zv X @6 @z BT L ¨ h L @ ` % J }@ | 4 ~ } ~ ' K }@ |> 4 ~ } ~ ( L }@ | 4 ~ } ~ & I }@ |n 4 ~ } ~ J }@ | 4 ~ } ~ b J }@ | 4 ~ } ~ D H a D H @ A θ ʈ ^ L @ d lj " l *H
*H
*H
*H
*H
*H
*H
*H
*H
*H
UUUUUUU
U U*H
*H
*H
*H
*H
*H
*H
*H
*H
++ +++<*H
++*H
+*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
`HB`HB`HB+*H
+
+ *H
*H
+`HB`HB`HB`HB`HB`HB`HB `HB
`HBU U U U U U U U U U #+UUeUdU*UU+U-U +UU U
*H}B
*H}B *H8+ *H8+$+$*H
))U %++++++++7+7+7
+7
+7
`HBU U U +e*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
++*H
*H
*H
*H
+7*H
U)U.++0++0+0+ (**H*H8*H8*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
*H
+ +++++++ +
+ + + + + + + + + + + +
+ + +
+ + + ++++++++ +++++
+++++++++ +
+ + +
+++++++++++++++++++++++++ +
+ +++++++++++ + + + + +
+
+
+
+
+ + + + +0+0+0+0+0+0+0+0+0+0+0 +0
+0 ++ U++++++++++X &,d &,d
PUU7*H
+
+ +
UHU $U 7U 8 3 ) J "
K Q X > ` ?f h p y o c N
I . ) ) &
=
?E hE i i X X D D > > / / '
? ! ? " # $ ? % $ & ' ( ?N | ) , t _ * 1 S G + ? : , 6 2 * - > ! . / C 0 K 1 T 2 ] 3 f 4 o 5 x 6 7 s s 8 j L 9 B # : ; < = > ? > @ > A ~ s B k Y C I 3 D , , E > F G H I J k K ] F L 6 M N ! O * P Q 3 R 5 p S 8 Z : T ; + U > V A W D X G h Y J Q 1 Z M * # [ P \ ] ^ _ Y ` ] a b c a d d e g f j n O g m D 9 h p 6 ) i u ' ! j x k { l ~ m n o p > q r > s q t g ] u O > w 6 . x & y z { | } ~ n c E 9 ,
p
j L
F &
" , 5 8 ; > s [
C K 4
M &
W
a
k ~
u w w c c [ [ T T J J : : - - " "
u a R = $ . - 6
? I 4 4 R U X _ o f j j n ` U v I < ~ 8 >= , ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~
~ ~
~ ~
~ ~
~ ~
~ ~
~u ~u
~d ~d ~S ~S ~B ~B ~. ~. ~ ~ ! } } , } } 7 } } B } } M } } X }q }q c }] }] n }I }I y }1 }1 } } | | | | | | | | | | |v |v |Y |Y |; |; |& |& | | { { { { { { { { ) {z {z 4 {^ {^ ? {? {? J { { U { { ` z z k z z v z z z z zm zm zL zL z/ z/ z z y y y y y y y y y y yu yu y` y` yN yN y5 y5 y y & y y 1 x x < x x G x x R x x ] xv xv h xW xW s x6 x6 ~ x x x x
x x w w w w w w w w w w w w w w w w
w w w w w w
w w w~ w~ wi wi w] w] wR wR w< w< w& w& ! w w ) w w 1 v v 9 v v A v v I v v Q v v Y v v a v vu i vh vh q vY vY y vL vL vA vA ! v0 v0 " v v # v v $ u u % u u & u u ' u u ( u u ) u u * uv uv + u` u` , uI uI - u3 u3 . u" u" / u u 0 t t 1 t t 2 t t 3 t t 4 ! t t 5 ) t t 6 1 tk tk 7 9 tV tV 8 A tK tK 9 I t@ t@ : Q t, t, ; Y t t < b s s = k s s > t s s ? } s s @ s s A s s B ss ss C s` s` D sH sH E s: s: F s( s( G s s H r r I r r J r r K r r L r r M r r N r r O rp rp P r[ r[ Q rL rL R r> r> S ! r) r) T ) r r U 1 r r V 9 q q W A q q X I q q Y Q q q Z Y q q [ a q q \ i qp qp ] q qb qb _ y qF qF ` q, q, a q q b p p c p p d p p e p p f p p g p p h p p i p p j pw pf k p^ pV l pD p0 m p* p n p p
o o o p o o q
o o r o o s o om t ( og og u 1 v : o] oR w C oH oH x L o; o; y P o, o z U o o { W o n | X n n } Z n n ~ ] n n a n n e n n i n n m n n q n nz u nn nb y nY nP z nM n=
} n6
n& n m m m m m m m m m m mt mt mo mo m] mC m1 m m l P h 0 0 p h H h ` X H @ ( 0 ( x ` x P x x ( H ` @ X @ p X @ 8 P h p ( h p H 0 8 H x ` 8 x p X h ( @ h ( 0 @ X H X X @ ( ` p 8 H 0 x ` p ( 0 ` x H x h ` P 8 P h 0 @ 0 H p ( @ h P 8 8 H h p X @ ( P 0 ` x x H 0 ` P h ( @ p X 8 X p ( p X ` 8 0 p P H 8 P P 8 0 ` H X P ( 8 x x @ @ X ` H ` ( @ X p ( p X p 8 0 P x x 0 @ ( @ h p 0 @ x 8 p ` x P h 0 x X h H h 8 h p ` X H h ( 0 @ X H X X @ ( ` p 8 H 0 x ` p ( 0 ` x H x h ` P 8 P h 0 @ 0 H p h P 8 8 H h p X @ ( P 0 ` x x H 0 ` P h ( @ p X 8 ( @ 0 p ( x ` P ` x H H x ` ( 8 P P 8 0 X @ p X @ 8 P H X h P ( 8 H ( @ X ` @ P h 8 ` ( 0 H ` x @ X H x p 8 ` x X ( X 0 h ` 0 ( @ X p H 8 P P 0 ( @ @ 0 H ` x 8 P h ` ( ( @ @ ( X p @ 0 H ` x 8 ( @ X p 0 H ` x 8 P h ( @ X 0 p x 8 P H X p h ( @ 8 H ` x p h h P P h 0 H ` x p 0 p H ` x X p ( @ X p 0 H ` x 8 P h ( @ X p 0 H ` x 8 P h 8 P a 6 ~ p Q 4 4 j 8 @ ;z = B t F F W ` p D R L Z l
d M0123456789ABCDEF u + ) . C | = 6 T b s + L W < g B o N I / z h y ? " _ ! ] Z 2 ' 5 > 0 H ^ * V O 8 } v k t E p Y d q [ e - ` % F a i 4 @ ~ U G # Q : \ & , S
n ( A M R j 7 l $ { J x c m ; 9 f X w r u K
1 D P 3 pxݵ(yJ؝~7+vSbLdDYOaEm }2@놷{ !"\kNTe` sVu ;B=0<&oFiW' C>/f ހRr5Mj*qZItK^AnQ$Pp9|:#z6[%U1-]㊒)gl ឨ,c?X≩
843H _.G奜w
h @ P ` r 0 [ p D 7 + "
o _ P N A ` 3 p # 0 @ P ` p t h T > (
z i @ [ K 5 0 ! @ P ` p 0 l _ @ P P < . ` @ v h ` Z M p = 2 " 0 @ P ` p t c M 5 0 w
h
U C
5
0 (
@
P
`
p
y
l ` X p I p 8 (
0 @ P ` p r c P @ P % 0 @ x P e V E 3 0
@ P ` p x b S @ @ 4 * 0
z
0 f
@ X
P O
` A
p 1
d e f g h } i u j l k \ l T m C # n o p q r u s [ t D u 0 v w x u y g z U { A " | } ~ p X M = , | [ G / M @ # P ` p { q f [ O F = / % 0 @ P ` C p d , e f | g h i j k ^ } M l : { 3 m ) n o p q r s t u v { w c x M y P ~ 9 z . @ 5 P " ` p @ ` P ~ h ^ W O A 0 9 d e r f g h i j s k q l f m I @ 2 P & ` @ ` p r a R H P ? d l e Y f J i B j " k g h @ p P ` d @ M P ; ` , p d \ @ P p y m d # e @ \ P M ` B p 7 * 0 @ P q ` b p W L ? d m v e W f 5 g h i j k l l @ B 3 P ` 0 @ } p d S B p 1
P ` d p q z m r e Y s w @ + o f x g t h { i ] u C j T y - k M { | l } v ~ z m a n K @ P ` p d % e @ P ` x p f W D 6 # ` p v 0 c @ L P 4 d e f g w h s Z i M j ? k 1 l # m n o p q M r p p @ X < `
m ^ K 0 5 P ! ` p d e f g x h i j } k o l d m O n ? o * p q r s t u v w { t ` Z @ D P 6 ` p 0 o ` @ U ? p ) P u # t v d w » e ¬ x y f Y n Y D 3 g z s { { g h B | ( } ~ i o ^ j C k , l m n o p q r @ 0 d B @ V H P 0 ` p Ĭ đ t W @ ) õ 0 ë @ Þ P Õ ` z p o R d Ǥ e ǘ f g l h ] j W k B l ( m n # o z p Ƹ | Ơ } ƈ { q Z ~ D x 1 q y r Ť s Ŏ t u w v b w L< K ? 3 p ( @ P 0 ɴ ɨ @ ɕ Ʉ n ] 0 M ? 1 P Ⱥ p Ȧ ` Ȑ ` ȇ p | P k ` Y @ D 3 $ Ƿ v ͑ w ͆ d v e ] K 5 "
s f g t ̫ q ̙ h ̂ i i j \ k l J m 7 ( n ˶ ~ ˢ | ˔ v c y M ; & r } p z { ʸ o ʜ ʊ s x d u L V @ б P Ф ` Л p Ї n U F p 8 ϯ Ϙ { ^ C @ + 0 δ 0 Ι @ · P w ` i p Y I : ( ` P ͱ ͠ d B v . r e f q w s ѽ t ѩ g ј h ч i j j ] k : l u
m y x o p о z c c ; ; ; c ; ; ; ~ N
R J
d t b
[
x X ] x X ^ 8 x X \ x X l
X n X o j X m X P n X x J : z K : { L : P y I : B B θ ʈ ^ - t B q F @ d ˚ L @ ` _ ` ۚ ܂ $ u w ݚ ^ L @ d ) * L @ d d 0 b 0 D @ 0123456789ABCDEF U r V r V ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ >?456789:;<=
!"#$%&'()*+,-./0123 Y ( P X $ t
ֳ ֟ ց v _ J 9 ) \ %V g ' ' ' 'h % &t ~ /* /8 /t /P / / 6 6. 6F 6r 0 1 j8 j- ץ ~ ԣ ז ׇ ~ w q g _ M G ئ ؕ v e U C 2 $ ׳ G R d 6 6 2 S R d 6 6 H $ 6 d H 8 8b I $ 6 d H 8 8b J $ 6 d H 8 8b K $ 6 d H 8 8b L $ 6 d H 8 8b M $ 6 d H 8 8b N $ 6 d H 8 8b T 9 ; : 8 ; R * < = ? @ ?~ >R DT C A {V*ќ30}2KE1!ZAJMڠh,'_6>Ψ4? x$#Rgf`H Srn BP<N5+qt:ޖ
w7kyb|j"[]uaUQ ^Wc=lpY
G OX8o;eF~-{@ s&LJ%T(dmzDI֮.v\/ i)9LC ٣ H 9T
8 R 3 / + ' #
@ ( ( ( @ ( @ ( 0 1 ( 6 ( 7 ( c ( d ( e ( ( @ @ @
H t l ͚ Ͷ ؒ ش D l ͚ Ͷ ؒ ش ./info/ 755 0 0 0 7445172707 5025 ./info/wget.info 644 0 0 5011 7445172706 6731 This is wget.info, produced by makeinfo version 4.1 from wget.texi.
INFO-DIR-SECTION Net Utilities
INFO-DIR-SECTION World Wide Web
START-INFO-DIR-ENTRY
* Wget: (wget). The non-interactive network downloader.
END-INFO-DIR-ENTRY
This file documents the the GNU Wget utility for downloading network
data.
Copyright (C) 1996, 1997, 1998, 2000, 2001 Free Software Foundation,
Inc.
Permission is granted to make and distribute verbatim copies of this
manual provided the copyright notice and this permission notice are
preserved on all copies.
Permission is granted to copy, distribute and/or modify this document
under the terms of the GNU Free Documentation License, Version 1.1 or
any later version published by the Free Software Foundation; with the
Invariant Sections being "GNU General Public License" and "GNU Free
Documentation License", with no Front-Cover Texts, and with no
Back-Cover Texts. A copy of the license is included in the section
entitled "GNU Free Documentation License".
Indirect:
wget.info-1: 1016
wget.info-2: 50394
wget.info-3: 99886
wget.info-4: 145592
Tag Table:
(Indirect)
Node: Top1016
Node: Overview1924
Node: Invoking5040
Node: URL Format5849
Ref: URL Format-Footnote-18077
Node: Option Syntax8179
Node: Basic Startup Options9605
Node: Logging and Input File Options10305
Node: Download Options12831
Node: Directory Options23795
Node: HTTP Options26278
Node: FTP Options33977
Node: Recursive Retrieval Options37256
Node: Recursive Accept/Reject Options43400
Node: Recursive Retrieval46369
Node: Following Links49457
Node: Spanning Hosts50394
Node: Types of Files52585
Node: Directory-Based Limits55040
Node: Relative Links57685
Node: FTP Links58517
Node: Time-Stamping59379
Node: Time-Stamping Usage61022
Node: HTTP Time-Stamping Internals62865
Ref: HTTP Time-Stamping Internals-Footnote-164136
Node: FTP Time-Stamping Internals64335
Node: Startup File65796
Node: Wgetrc Location66669
Node: Wgetrc Syntax67484
Node: Wgetrc Commands68199
Node: Sample Wgetrc76895
Node: Examples81985
Node: Simple Usage82324
Node: Advanced Usage83741
Node: Very Advanced Usage87261
Node: Various88721
Node: Proxies89245
Node: Distribution92013
Node: Mailing List92356
Node: Reporting Bugs93134
Node: Portability94867
Node: Signals96238
Node: Appendices96893
Node: Robots97211
Node: Security Considerations99886
Node: Contributors100882
Node: Copying104054
Node: GNU General Public License106665
Node: GNU Free Documentation License125863
Node: Concept Index145592
End Tag Table
@
H t l ͚ Ͷ ؒ ش D l ͚ Ͷ ؒ ش ./info/wget.info-1 644 0 0 142332 7445172706 7137 This is wget.info, produced by makeinfo version 4.1 from wget.texi.
INFO-DIR-SECTION Net Utilities
INFO-DIR-SECTION World Wide Web
START-INFO-DIR-ENTRY
* Wget: (wget). The non-interactive network downloader.
END-INFO-DIR-ENTRY
This file documents the the GNU Wget utility for downloading network
data.
Copyright (C) 1996, 1997, 1998, 2000, 2001 Free Software Foundation,
Inc.
Permission is granted to make and distribute verbatim copies of this
manual provided the copyright notice and this permission notice are
preserved on all copies.
Permission is granted to copy, distribute and/or modify this document
under the terms of the GNU Free Documentation License, Version 1.1 or
any later version published by the Free Software Foundation; with the
Invariant Sections being "GNU General Public License" and "GNU Free
Documentation License", with no Front-Cover Texts, and with no
Back-Cover Texts. A copy of the license is included in the section
entitled "GNU Free Documentation License".
File: wget.info, Node: Top, Next: Overview, Prev: (dir), Up: (dir)
Wget 1.8.1
**********
This manual documents version 1.8.1 of GNU Wget, the freely
available utility for network download.
Copyright (C) 1996, 1997, 1998, 2000, 2001 Free Software Foundation,
Inc.
* Menu:
* Overview:: Features of Wget.
* Invoking:: Wget command-line arguments.
* Recursive Retrieval:: Description of recursive retrieval.
* Following Links:: The available methods of chasing links.
* Time-Stamping:: Mirroring according to time-stamps.
* Startup File:: Wget's initialization file.
* Examples:: Examples of usage.
* Various:: The stuff that doesn't fit anywhere else.
* Appendices:: Some useful references.
* Copying:: You may give out copies of Wget and of this manual.
* Concept Index:: Topics covered by this manual.
File: wget.info, Node: Overview, Next: Invoking, Prev: Top, Up: Top
Overview
********
GNU Wget is a free utility for non-interactive download of files from
the Web. It supports HTTP, HTTPS, and FTP protocols, as well as
retrieval through HTTP proxies.
This chapter is a partial overview of Wget's features.
* Wget is non-interactive, meaning that it can work in the
background, while the user is not logged on. This allows you to
start a retrieval and disconnect from the system, letting Wget
finish the work. By contrast, most of the Web browsers require
constant user's presence, which can be a great hindrance when
transferring a lot of data.
* Wget can follow links in HTML pages and create local versions of
remote web sites, fully recreating the directory structure of the
original site. This is sometimes referred to as "recursive
downloading." While doing that, Wget respects the Robot Exclusion
Standard (`/robots.txt'). Wget can be instructed to convert the
links in downloaded HTML files to the local files for offline
viewing.
* File name wildcard matching and recursive mirroring of directories
are available when retrieving via FTP. Wget can read the
time-stamp information given by both HTTP and FTP servers, and
store it locally. Thus Wget can see if the remote file has
changed since last retrieval, and automatically retrieve the new
version if it has. This makes Wget suitable for mirroring of FTP
sites, as well as home pages.
* Wget has been designed for robustness over slow or unstable network
connections; if a download fails due to a network problem, it will
keep retrying until the whole file has been retrieved. If the
server supports regetting, it will instruct the server to continue
the download from where it left off.
* Wget supports proxy servers, which can lighten the network load,
speed up retrieval and provide access behind firewalls. However,
if you are behind a firewall that requires that you use a socks
style gateway, you can get the socks library and build Wget with
support for socks. Wget also supports the passive FTP downloading
as an option.
* Builtin features offer mechanisms to tune which links you wish to
follow (*note Following Links::).
* The retrieval is conveniently traced with printing dots, each dot
representing a fixed amount of data received (1KB by default).
These representations can be customized to your preferences.
* Most of the features are fully configurable, either through
command line options, or via the initialization file `.wgetrc'
(*note Startup File::). Wget allows you to define "global"
startup files (`/usr/local/etc/wgetrc' by default) for site
settings.
* Finally, GNU Wget is free software. This means that everyone may
use it, redistribute it and/or modify it under the terms of the
GNU General Public License, as published by the Free Software
Foundation (*note Copying::).
File: wget.info, Node: Invoking, Next: Recursive Retrieval, Prev: Overview, Up: Top
Invoking
********
By default, Wget is very simple to invoke. The basic syntax is:
wget [OPTION]... [URL]...
Wget will simply download all the URLs specified on the command
line. URL is a "Uniform Resource Locator", as defined below.
However, you may wish to change some of the default parameters of
Wget. You can do it two ways: permanently, adding the appropriate
command to `.wgetrc' (*note Startup File::), or specifying it on the
command line.
* Menu:
* URL Format::
* Option Syntax::
* Basic Startup Options::
* Logging and Input File Options::
* Download Options::
* Directory Options::
* HTTP Options::
* FTP Options::
* Recursive Retrieval Options::
* Recursive Accept/Reject Options::
File: wget.info, Node: URL Format, Next: Option Syntax, Prev: Invoking, Up: Invoking
URL Format
==========
"URL" is an acronym for Uniform Resource Locator. A uniform
resource locator is a compact string representation for a resource
available via the Internet. Wget recognizes the URL syntax as per
RFC1738. This is the most widely used form (square brackets denote
optional parts):
http://host[:port]/directory/file
ftp://host[:port]/directory/file
You can also encode your username and password within a URL:
ftp://user:password@host/path
http://user:password@host/path
Either USER or PASSWORD, or both, may be left out. If you leave out
either the HTTP username or password, no authentication will be sent.
If you leave out the FTP username, `anonymous' will be used. If you
leave out the FTP password, your email address will be supplied as a
default password.(1)
You can encode unsafe characters in a URL as `%xy', `xy' being the
hexadecimal representation of the character's ASCII value. Some common
unsafe characters include `%' (quoted as `%25'), `:' (quoted as `%3A'),
and `@' (quoted as `%40'). Refer to RFC1738 for a comprehensive list
of unsafe characters.
Wget also supports the `type' feature for FTP URLs. By default, FTP
documents are retrieved in the binary mode (type `i'), which means that
they are downloaded unchanged. Another useful mode is the `a'
("ASCII") mode, which converts the line delimiters between the
different operating systems, and is thus useful for text files. Here
is an example:
ftp://host/directory/file;type=a
Two alternative variants of URL specification are also supported,
because of historical (hysterical?) reasons and their widespreaded use.
FTP-only syntax (supported by `NcFTP'):
host:/dir/file
HTTP-only syntax (introduced by `Netscape'):
host[:port]/dir/file
These two alternative forms are deprecated, and may cease being
supported in the future.
If you do not understand the difference between these notations, or
do not know which one to use, just use the plain ordinary format you use
with your favorite browser, like `Lynx' or `Netscape'.
---------- Footnotes ----------
(1) If you have a `.netrc' file in your home directory, password
will also be searched for there.
File: wget.info, Node: Option Syntax, Next: Basic Startup Options, Prev: URL Format, Up: Invoking
Option Syntax
=============
Since Wget uses GNU getopts to process its arguments, every option
has a short form and a long form. Long options are more convenient to
remember, but take time to type. You may freely mix different option
styles, or specify options after the command-line arguments. Thus you
may write:
wget -r --tries=10 http://fly.srk.fer.hr/ -o log
The space between the option accepting an argument and the argument
may be omitted. Instead `-o log' you can write `-olog'.
You may put several options that do not require arguments together,
like:
wget -drc URL
This is a complete equivalent of:
wget -d -r -c URL
Since the options can be specified after the arguments, you may
terminate them with `--'. So the following will try to download URL
`-x', reporting failure to `log':
wget -o log -- -x
The options that accept comma-separated lists all respect the
convention that specifying an empty list clears its value. This can be
useful to clear the `.wgetrc' settings. For instance, if your `.wgetrc'
sets `exclude_directories' to `/cgi-bin', the following example will
first reset it, and then set it to exclude `/~nobody' and `/~somebody'.
You can also clear the lists in `.wgetrc' (*note Wgetrc Syntax::).
wget -X '' -X /~nobody,/~somebody
File: wget.info, Node: Basic Startup Options, Next: Logging and Input File Options, Prev: Option Syntax, Up: Invoking
Basic Startup Options
=====================
`-V'
`--version'
Display the version of Wget.
`-h'
`--help'
Print a help message describing all of Wget's command-line options.
`-b'
`--background'
Go to background immediately after startup. If no output file is
specified via the `-o', output is redirected to `wget-log'.
`-e COMMAND'
`--execute COMMAND'
Execute COMMAND as if it were a part of `.wgetrc' (*note Startup
File::). A command thus invoked will be executed _after_ the
commands in `.wgetrc', thus taking precedence over them.
File: wget.info, Node: Logging and Input File Options, Next: Download Options, Prev: Basic Startup Options, Up: Invoking
Logging and Input File Options
==============================
`-o LOGFILE'
`--output-file=LOGFILE'
Log all messages to LOGFILE. The messages are normally reported
to standard error.
`-a LOGFILE'
`--append-output=LOGFILE'
Append to LOGFILE. This is the same as `-o', only it appends to
LOGFILE instead of overwriting the old log file. If LOGFILE does
not exist, a new file is created.
`-d'
`--debug'
Turn on debug output, meaning various information important to the
developers of Wget if it does not work properly. Your system
administrator may have chosen to compile Wget without debug
support, in which case `-d' will not work. Please note that
compiling with debug support is always safe--Wget compiled with
the debug support will _not_ print any debug info unless requested
with `-d'. *Note Reporting Bugs::, for more information on how to
use `-d' for sending bug reports.
`-q'
`--quiet'
Turn off Wget's output.
`-v'
`--verbose'
Turn on verbose output, with all the available data. The default
output is verbose.
`-nv'
`--non-verbose'
Non-verbose output--turn off verbose without being completely quiet
(use `-q' for that), which means that error messages and basic
information still get printed.
`-i FILE'
`--input-file=FILE'
Read URLs from FILE, in which case no URLs need to be on the
command line. If there are URLs both on the command line and in
an input file, those on the command lines will be the first ones to
be retrieved. The FILE need not be an HTML document (but no harm
if it is)--it is enough if the URLs are just listed sequentially.
However, if you specify `--force-html', the document will be
regarded as `html'. In that case you may have problems with
relative links, which you can solve either by adding `' tag pointing to external document
`2.html'. Say that `2.html' is similar but that its image is
`2.gif' and it links to `3.html'. Say this continues up to some
arbitrarily high number.
If one executes the command:
wget -r -l 2 http://SITE/1.html
then `1.html', `1.gif', `2.html', `2.gif', and `3.html' will be
downloaded. As you can see, `3.html' is without its requisite
`3.gif' because Wget is simply counting the number of hops (up to
2) away from `1.html' in order to determine where to stop the
recursion. However, with this command:
wget -r -l 2 -p http://SITE/1.html
all the above files _and_ `3.html''s requisite `3.gif' will be
downloaded. Similarly,
wget -r -l 1 -p http://SITE/1.html
will cause `1.html', `1.gif', `2.html', and `2.gif' to be
downloaded. One might think that:
wget -r -l 0 -p http://SITE/1.html
would download just `1.html' and `1.gif', but unfortunately this
is not the case, because `-l 0' is equivalent to `-l inf'--that
is, infinite recursion. To download a single HTML page (or a
handful of them, all specified on the commandline or in a `-i' URL
input file) and its (or their) requisites, simply leave off `-r'
and `-l':
wget -p http://SITE/1.html
Note that Wget will behave as if `-r' had been specified, but only
that single page and its requisites will be downloaded. Links
from that page to external documents will not be followed.
Actually, to download a single page and all its requisites (even
if they exist on separate websites), and make sure the lot
displays properly locally, this author likes to use a few options
in addition to `-p':
wget -E -H -k -K -p http://SITE/DOCUMENT
To finish off this topic, it's worth knowing that Wget's idea of an
external document link is any URL specified in an ` ' tag, an
`
These links are not relative:
Using this option guarantees that recursive retrieval will not span
hosts, even without `-H'. In simple cases it also allows downloads to
"just work" without having to convert links.
This option is probably not very useful and might be removed in a
future release.
File: wget.info, Node: FTP Links, Prev: Relative Links, Up: Following Links
Following FTP Links
===================
The rules for FTP are somewhat specific, as it is necessary for them
to be. FTP links in HTML documents are often included for purposes of
reference, and it is often inconvenient to download them by default.
To have FTP links followed from HTML documents, you need to specify
the `--follow-ftp' option. Having done that, FTP links will span hosts
regardless of `-H' setting. This is logical, as FTP links rarely point
to the same host where the HTTP server resides. For similar reasons,
the `-L' options has no effect on such downloads. On the other hand,
domain acceptance (`-D') and suffix rules (`-A' and `-R') apply
normally.
Also note that followed links to FTP directories will not be
retrieved recursively further.
File: wget.info, Node: Time-Stamping, Next: Startup File, Prev: Following Links, Up: Top
Time-Stamping
*************
One of the most important aspects of mirroring information from the
Internet is updating your archives.
Downloading the whole archive again and again, just to replace a few
changed files is expensive, both in terms of wasted bandwidth and money,
and the time to do the update. This is why all the mirroring tools
offer the option of incremental updating.
Such an updating mechanism means that the remote server is scanned in
search of "new" files. Only those new files will be downloaded in the
place of the old ones.
A file is considered new if one of these two conditions are met:
1. A file of that name does not already exist locally.
2. A file of that name does exist, but the remote file was modified
more recently than the local file.
To implement this, the program needs to be aware of the time of last
modification of both local and remote files. We call this information
the "time-stamp" of a file.
The time-stamping in GNU Wget is turned on using `--timestamping'
(`-N') option, or through `timestamping = on' directive in `.wgetrc'.
With this option, for each file it intends to download, Wget will check
whether a local file of the same name exists. If it does, and the
remote file is older, Wget will not download it.
If the local file does not exist, or the sizes of the files do not
match, Wget will download the remote file no matter what the time-stamps
say.
* Menu:
* Time-Stamping Usage::
* HTTP Time-Stamping Internals::
* FTP Time-Stamping Internals::
File: wget.info, Node: Time-Stamping Usage, Next: HTTP Time-Stamping Internals, Prev: Time-Stamping, Up: Time-Stamping
Time-Stamping Usage
===================
The usage of time-stamping is simple. Say you would like to
download a file so that it keeps its date of modification.
wget -S http://www.gnu.ai.mit.edu/
A simple `ls -l' shows that the time stamp on the local file equals
the state of the `Last-Modified' header, as returned by the server. As
you can see, the time-stamping info is preserved locally, even without
`-N' (at least for HTTP).
Several days later, you would like Wget to check if the remote file
has changed, and download it if it has.
wget -N http://www.gnu.ai.mit.edu/
Wget will ask the server for the last-modified date. If the local
file has the same timestamp as the server, or a newer one, the remote
file will not be re-fetched. However, if the remote file is more
recent, Wget will proceed to fetch it.
The same goes for FTP. For example:
wget "ftp://ftp.ifi.uio.no/pub/emacs/gnus/*"
(The quotes around that URL are to prevent the shell from trying to
interpret the `*'.)
After download, a local directory listing will show that the
timestamps match those on the remote server. Reissuing the command
with `-N' will make Wget re-fetch _only_ the files that have been
modified since the last download.
If you wished to mirror the GNU archive every week, you would use a
command like the following, weekly:
wget --timestamping -r ftp://ftp.gnu.org/pub/gnu/
Note that time-stamping will only work for files for which the server
gives a timestamp. For HTTP, this depends on getting a `Last-Modified'
header. For FTP, this depends on getting a directory listing with
dates in a format that Wget can parse (*note FTP Time-Stamping
Internals::).
File: wget.info, Node: HTTP Time-Stamping Internals, Next: FTP Time-Stamping Internals, Prev: Time-Stamping Usage, Up: Time-Stamping
HTTP Time-Stamping Internals
============================
Time-stamping in HTTP is implemented by checking of the
`Last-Modified' header. If you wish to retrieve the file `foo.html'
through HTTP, Wget will check whether `foo.html' exists locally. If it
doesn't, `foo.html' will be retrieved unconditionally.
If the file does exist locally, Wget will first check its local
time-stamp (similar to the way `ls -l' checks it), and then send a
`HEAD' request to the remote server, demanding the information on the
remote file.
The `Last-Modified' header is examined to find which file was
modified more recently (which makes it "newer"). If the remote file is
newer, it will be downloaded; if it is older, Wget will give up.(1)
When `--backup-converted' (`-K') is specified in conjunction with
`-N', server file `X' is compared to local file `X.orig', if extant,
rather than being compared to local file `X', which will always differ
if it's been converted by `--convert-links' (`-k').
Arguably, HTTP time-stamping should be implemented using the
`If-Modified-Since' request.
---------- Footnotes ----------
(1) As an additional check, Wget will look at the `Content-Length'
header, and compare the sizes; if they are not the same, the remote
file will be downloaded no matter what the time-stamp says.
File: wget.info, Node: FTP Time-Stamping Internals, Prev: HTTP Time-Stamping Internals, Up: Time-Stamping
FTP Time-Stamping Internals
===========================
In theory, FTP time-stamping works much the same as HTTP, only FTP
has no headers--time-stamps must be ferreted out of directory listings.
If an FTP download is recursive or uses globbing, Wget will use the
FTP `LIST' command to get a file listing for the directory containing
the desired file(s). It will try to analyze the listing, treating it
like Unix `ls -l' output, extracting the time-stamps. The rest is
exactly the same as for HTTP. Note that when retrieving individual
files from an FTP server without using globbing or recursion, listing
files will not be downloaded (and thus files will not be time-stamped)
unless `-N' is specified.
Assumption that every directory listing is a Unix-style listing may
sound extremely constraining, but in practice it is not, as many
non-Unix FTP servers use the Unixoid listing format because most (all?)
of the clients understand it. Bear in mind that RFC959 defines no
standard way to get a file list, let alone the time-stamps. We can
only hope that a future standard will define this.
Another non-standard solution includes the use of `MDTM' command
that is supported by some FTP servers (including the popular
`wu-ftpd'), which returns the exact time of the specified file. Wget
may support this command in the future.
File: wget.info, Node: Startup File, Next: Examples, Prev: Time-Stamping, Up: Top
Startup File
************
Once you know how to change default settings of Wget through command
line arguments, you may wish to make some of those settings permanent.
You can do that in a convenient way by creating the Wget startup
file--`.wgetrc'.
Besides `.wgetrc' is the "main" initialization file, it is
convenient to have a special facility for storing passwords. Thus Wget
reads and interprets the contents of `$HOME/.netrc', if it finds it.
You can find `.netrc' format in your system manuals.
Wget reads `.wgetrc' upon startup, recognizing a limited set of
commands.
* Menu:
* Wgetrc Location:: Location of various wgetrc files.
* Wgetrc Syntax:: Syntax of wgetrc.
* Wgetrc Commands:: List of available commands.
* Sample Wgetrc:: A wgetrc example.
File: wget.info, Node: Wgetrc Location, Next: Wgetrc Syntax, Prev: Startup File, Up: Startup File
Wgetrc Location
===============
When initializing, Wget will look for a "global" startup file,
`/usr/local/etc/wgetrc' by default (or some prefix other than
`/usr/local', if Wget was not installed there) and read commands from
there, if it exists.
Then it will look for the user's file. If the environmental variable
`WGETRC' is set, Wget will try to load that file. Failing that, no
further attempts will be made.
If `WGETRC' is not set, Wget will try to load `$HOME/.wgetrc'.
The fact that user's settings are loaded after the system-wide ones
means that in case of collision user's wgetrc _overrides_ the
system-wide wgetrc (in `/usr/local/etc/wgetrc' by default). Fascist
admins, away!
File: wget.info, Node: Wgetrc Syntax, Next: Wgetrc Commands, Prev: Wgetrc Location, Up: Startup File
Wgetrc Syntax
=============
The syntax of a wgetrc command is simple:
variable = value
The "variable" will also be called "command". Valid "values" are
different for different commands.
The commands are case-insensitive and underscore-insensitive. Thus
`DIr__PrefiX' is the same as `dirprefix'. Empty lines, lines beginning
with `#' and lines containing white-space only are discarded.
Commands that expect a comma-separated list will clear the list on an
empty command. So, if you wish to reset the rejection list specified in
global `wgetrc', you can do it with:
reject =
File: wget.info, Node: Wgetrc Commands, Next: Sample Wgetrc, Prev: Wgetrc Syntax, Up: Startup File
Wgetrc Commands
===============
The complete set of commands is listed below. Legal values are
listed after the `='. Simple Boolean values can be set or unset using
`on' and `off' or `1' and `0'. A fancier kind of Boolean allowed in
some cases is the "lockable Boolean", which may be set to `on', `off',
`always', or `never'. If an option is set to `always' or `never', that
value will be locked in for the duration of the Wget
invocation--commandline options will not override.
Some commands take pseudo-arbitrary values. ADDRESS values can be
hostnames or dotted-quad IP addresses. N can be any positive integer,
or `inf' for infinity, where appropriate. STRING values can be any
non-empty string.
Most of these commands have commandline equivalents (*note
Invoking::), though some of the more obscure or rarely used ones do not.
accept/reject = STRING
Same as `-A'/`-R' (*note Types of Files::).
add_hostdir = on/off
Enable/disable host-prefixed file names. `-nH' disables it.
continue = on/off
If set to on, force continuation of preexistent partially retrieved
files. See `-c' before setting it.
background = on/off
Enable/disable going to background--the same as `-b' (which
enables it).
backup_converted = on/off
Enable/disable saving pre-converted files with the suffix
`.orig'--the same as `-K' (which enables it).
base = STRING
Consider relative URLs in URL input files forced to be interpreted
as HTML as being relative to STRING--the same as `-B'.
bind_address = ADDRESS
Bind to ADDRESS, like the `--bind-address' option.
cache = on/off
When set to off, disallow server-caching. See the `-C' option.
convert links = on/off
Convert non-relative links locally. The same as `-k'.
cookies = on/off
When set to off, disallow cookies. See the `--cookies' option.
load_cookies = FILE
Load cookies from FILE. See `--load-cookies'.
save_cookies = FILE
Save cookies to FILE. See `--save-cookies'.
cut_dirs = N
Ignore N remote directory components.
debug = on/off
Debug mode, same as `-d'.
delete_after = on/off
Delete after download--the same as `--delete-after'.
dir_prefix = STRING
Top of directory tree--the same as `-P'.
dirstruct = on/off
Turning dirstruct on or off--the same as `-x' or `-nd',
respectively.
domains = STRING
Same as `-D' (*note Spanning Hosts::).
dot_bytes = N
Specify the number of bytes "contained" in a dot, as seen
throughout the retrieval (1024 by default). You can postfix the
value with `k' or `m', representing kilobytes and megabytes,
respectively. With dot settings you can tailor the dot retrieval
to suit your needs, or you can use the predefined "styles" (*note
Download Options::).
dots_in_line = N
Specify the number of dots that will be printed in each line
throughout the retrieval (50 by default).
dot_spacing = N
Specify the number of dots in a single cluster (10 by default).
exclude_directories = STRING
Specify a comma-separated list of directories you wish to exclude
from download--the same as `-X' (*note Directory-Based Limits::).
exclude_domains = STRING
Same as `--exclude-domains' (*note Spanning Hosts::).
follow_ftp = on/off
Follow FTP links from HTML documents--the same as `--follow-ftp'.
follow_tags = STRING
Only follow certain HTML tags when doing a recursive retrieval,
just like `--follow-tags'.
force_html = on/off
If set to on, force the input filename to be regarded as an HTML
document--the same as `-F'.
ftp_proxy = STRING
Use STRING as FTP proxy, instead of the one specified in
environment.
glob = on/off
Turn globbing on/off--the same as `-g'.
header = STRING
Define an additional header, like `--header'.
html_extension = on/off
Add a `.html' extension to `text/html' files without it, like `-E'.
http_passwd = STRING
Set HTTP password.
http_proxy = STRING
Use STRING as HTTP proxy, instead of the one specified in
environment.
http_user = STRING
Set HTTP user to STRING.
ignore_length = on/off
When set to on, ignore `Content-Length' header; the same as
`--ignore-length'.
ignore_tags = STRING
Ignore certain HTML tags when doing a recursive retrieval, just
like `-G' / `--ignore-tags'.
include_directories = STRING
Specify a comma-separated list of directories you wish to follow
when downloading--the same as `-I'.
input = STRING
Read the URLs from STRING, like `-i'.
kill_longer = on/off
Consider data longer than specified in content-length header as
invalid (and retry getting it). The default behaviour is to save
as much data as there is, provided there is more than or equal to
the value in `Content-Length'.
logfile = STRING
Set logfile--the same as `-o'.
login = STRING
Your user name on the remote machine, for FTP. Defaults to
`anonymous'.
mirror = on/off
Turn mirroring on/off. The same as `-m'.
netrc = on/off
Turn reading netrc on or off.
noclobber = on/off
Same as `-nc'.
no_parent = on/off
Disallow retrieving outside the directory hierarchy, like
`--no-parent' (*note Directory-Based Limits::).
no_proxy = STRING
Use STRING as the comma-separated list of domains to avoid in
proxy loading, instead of the one specified in environment.
output_document = STRING
Set the output filename--the same as `-O'.
page_requisites = on/off
Download all ancillary documents necessary for a single HTML page
to display properly--the same as `-p'.
passive_ftp = on/off/always/never
Set passive FTP--the same as `--passive-ftp'. Some scripts and
`.pm' (Perl module) files download files using `wget
--passive-ftp'. If your firewall does not allow this, you can set
`passive_ftp = never' to override the commandline.
passwd = STRING
Set your FTP password to PASSWORD. Without this setting, the
password defaults to `username@hostname.domainname'.
progress = STRING
Set the type of the progress indicator. Legal types are "dot" and
"bar".
proxy_user = STRING
Set proxy authentication user name to STRING, like `--proxy-user'.
proxy_passwd = STRING
Set proxy authentication password to STRING, like `--proxy-passwd'.
referer = STRING
Set HTTP `Referer:' header just like `--referer'. (Note it was
the folks who wrote the HTTP spec who got the spelling of
"referrer" wrong.)
quiet = on/off
Quiet mode--the same as `-q'.
quota = QUOTA
Specify the download quota, which is useful to put in the global
`wgetrc'. When download quota is specified, Wget will stop
retrieving after the download sum has become greater than quota.
The quota can be specified in bytes (default), kbytes `k'
appended) or mbytes (`m' appended). Thus `quota = 5m' will set
the quota to 5 mbytes. Note that the user's startup file
overrides system settings.
reclevel = N
Recursion level--the same as `-l'.
recursive = on/off
Recursive on/off--the same as `-r'.
relative_only = on/off
Follow only relative links--the same as `-L' (*note Relative
Links::).
remove_listing = on/off
If set to on, remove FTP listings downloaded by Wget. Setting it
to off is the same as `-nr'.
retr_symlinks = on/off
When set to on, retrieve symbolic links as if they were plain
files; the same as `--retr-symlinks'.
robots = on/off
Use (or not) `/robots.txt' file (*note Robots::). Be sure to know
what you are doing before changing the default (which is `on').
server_response = on/off
Choose whether or not to print the HTTP and FTP server
responses--the same as `-S'.
span_hosts = on/off
Same as `-H'.
timeout = N
Set timeout value--the same as `-T'.
timestamping = on/off
Turn timestamping on/off. The same as `-N' (*note
Time-Stamping::).
tries = N
Set number of retries per URL--the same as `-t'.
use_proxy = on/off
Turn proxy support on/off. The same as `-Y'.
verbose = on/off
Turn verbose on/off--the same as `-v'/`-nv'.
wait = N
Wait N seconds between retrievals--the same as `-w'.
waitretry = N
Wait up to N seconds between retries of failed retrievals
only--the same as `--waitretry'. Note that this is turned on by
default in the global `wgetrc'.
randomwait = on/off
Turn random between-request wait times on or off. The same as
`--random-wait'.
File: wget.info, Node: Sample Wgetrc, Prev: Wgetrc Commands, Up: Startup File
Sample Wgetrc
=============
This is the sample initialization file, as given in the distribution.
It is divided in two section--one for global usage (suitable for global
startup file), and one for local usage (suitable for `$HOME/.wgetrc').
Be careful about the things you change.
Note that almost all the lines are commented out. For a command to
have any effect, you must remove the `#' character at the beginning of
its line.
###
### Sample Wget initialization file .wgetrc
###
## You can use this file to change the default behaviour of wget or to
## avoid having to type many many command-line options. This file does
## not contain a comprehensive list of commands -- look at the manual
## to find out what you can put into this file.
##
## Wget initialization file can reside in /usr/local/etc/wgetrc
## (global, for all users) or $HOME/.wgetrc (for a single user).
##
## To use the settings in this file, you will have to uncomment them,
## as well as change them, in most cases, as the values on the
## commented-out lines are the default values (e.g. "off").
##
## Global settings (useful for setting up in /usr/local/etc/wgetrc).
## Think well before you change them, since they may reduce wget's
## functionality, and make it behave contrary to the documentation:
##
# You can set retrieve quota for beginners by specifying a value
# optionally followed by 'K' (kilobytes) or 'M' (megabytes). The
# default quota is unlimited.
#quota = inf
# You can lower (or raise) the default number of retries when
# downloading a file (default is 20).
#tries = 20
# Lowering the maximum depth of the recursive retrieval is handy to
# prevent newbies from going too "deep" when they unwittingly start
# the recursive retrieval. The default is 5.
#reclevel = 5
# Many sites are behind firewalls that do not allow initiation of
# connections from the outside. On these sites you have to use the
# `passive' feature of FTP. If you are behind such a firewall, you
# can turn this on to make Wget use passive FTP by default.
#passive_ftp = off
# The "wait" command below makes Wget wait between every connection.
# If, instead, you want Wget to wait only between retries of failed
# downloads, set waitretry to maximum number of seconds to wait (Wget
# will use "linear backoff", waiting 1 second after the first failure
# on a file, 2 seconds after the second failure, etc. up to this max).
waitretry = 10
##
## Local settings (for a user to set in his $HOME/.wgetrc). It is
## *highly* undesirable to put these settings in the global file, since
## they are potentially dangerous to "normal" users.
##
## Even when setting up your own ~/.wgetrc, you should know what you
## are doing before doing so.
##
# Set this to on to use timestamping by default:
#timestamping = off
# It is a good idea to make Wget send your email address in a `From:'
# header with your request (so that server administrators can contact
# you in case of errors). Wget does *not* send `From:' by default.
#header = From: Your Name
# You can set up other headers, like Accept-Language. Accept-Language
# is *not* sent by default.
#header = Accept-Language: en
# You can set the default proxies for Wget to use for http and ftp.
# They will override the value in the environment.
#http_proxy = http://proxy.yoyodyne.com:18023/
#ftp_proxy = http://proxy.yoyodyne.com:18023/
# If you do not want to use proxy at all, set this to off.
#use_proxy = on
# You can customize the retrieval outlook. Valid options are default,
# binary, mega and micro.
#dot_style = default
# Setting this to off makes Wget not download /robots.txt. Be sure to
# know *exactly* what /robots.txt is and how it is used before changing
# the default!
#robots = on
# It can be useful to make Wget wait between connections. Set this to
# the number of seconds you want Wget to wait.
#wait = 0
# You can force creating directory structure, even if a single is being
# retrieved, by setting this to on.
#dirstruct = off
# You can turn on recursive retrieving by default (don't do this if
# you are not sure you know what it means) by setting this to on.
#recursive = off
# To always back up file X as X.orig before converting its links (due
# to -k / --convert-links / convert_links = on having been specified),
# set this variable to on:
#backup_converted = off
# To have Wget follow FTP links from HTML files by default, set this
# to on:
#follow_ftp = off
File: wget.info, Node: Examples, Next: Various, Prev: Startup File, Up: Top
Examples
********
The examples are divided into three sections loosely based on their
complexity.
* Menu:
* Simple Usage:: Simple, basic usage of the program.
* Advanced Usage:: Advanced tips.
* Very Advanced Usage:: The hairy stuff.
File: wget.info, Node: Simple Usage, Next: Advanced Usage, Prev: Examples, Up: Examples
Simple Usage
============
* Say you want to download a URL. Just type:
wget http://fly.srk.fer.hr/
* But what will happen if the connection is slow, and the file is
lengthy? The connection will probably fail before the whole file
is retrieved, more than once. In this case, Wget will try getting
the file until it either gets the whole of it, or exceeds the
default number of retries (this being 20). It is easy to change
the number of tries to 45, to insure that the whole file will
arrive safely:
wget --tries=45 http://fly.srk.fer.hr/jpg/flyweb.jpg
* Now let's leave Wget to work in the background, and write its
progress to log file `log'. It is tiring to type `--tries', so we
shall use `-t'.
wget -t 45 -o log http://fly.srk.fer.hr/jpg/flyweb.jpg &
The ampersand at the end of the line makes sure that Wget works in
the background. To unlimit the number of retries, use `-t inf'.
* The usage of FTP is as simple. Wget will take care of login and
password.
wget ftp://gnjilux.srk.fer.hr/welcome.msg
* If you specify a directory, Wget will retrieve the directory
listing, parse it and convert it to HTML. Try:
wget ftp://prep.ai.mit.edu/pub/gnu/
links index.html
File: wget.info, Node: Advanced Usage, Next: Very Advanced Usage, Prev: Simple Usage, Up: Examples
Advanced Usage
==============
* You have a file that contains the URLs you want to download? Use
the `-i' switch:
wget -i FILE
If you specify `-' as file name, the URLs will be read from
standard input.
* Create a five levels deep mirror image of the GNU web site, with
the same directory structure the original has, with only one try
per document, saving the log of the activities to `gnulog':
wget -r http://www.gnu.org/ -o gnulog
* The same as the above, but convert the links in the HTML files to
point to local files, so you can view the documents off-line:
wget --convert-links -r http://www.gnu.org/ -o gnulog
* Retrieve only one HTML page, but make sure that all the elements
needed for the page to be displayed, such as inline images and
external style sheets, are also downloaded. Also make sure the
downloaded page references the downloaded links.
wget -p --convert-links http://www.server.com/dir/page.html
The HTML page will be saved to `www.server.com/dir/page.html', and
the images, stylesheets, etc., somewhere under `www.server.com/',
depending on where they were on the remote server.
* The same as the above, but without the `www.server.com/' directory.
In fact, I don't want to have all those random server directories
anyway--just save _all_ those files under a `download/'
subdirectory of the current directory.
wget -p --convert-links -nH -nd -Pdownload \
http://www.server.com/dir/page.html
* Retrieve the index.html of `www.lycos.com', showing the original
server headers:
wget -S http://www.lycos.com/
* Save the server headers with the file, perhaps for post-processing.
wget -s http://www.lycos.com/
more index.html
* Retrieve the first two levels of `wuarchive.wustl.edu', saving them
to `/tmp'.
wget -r -l2 -P/tmp ftp://wuarchive.wustl.edu/
* You want to download all the GIFs from a directory on an HTTP
server. You tried `wget http://www.server.com/dir/*.gif', but that
didn't work because HTTP retrieval does not support globbing. In
that case, use:
wget -r -l1 --no-parent -A.gif http://www.server.com/dir/
More verbose, but the effect is the same. `-r -l1' means to
retrieve recursively (*note Recursive Retrieval::), with maximum
depth of 1. `--no-parent' means that references to the parent
directory are ignored (*note Directory-Based Limits::), and
`-A.gif' means to download only the GIF files. `-A "*.gif"' would
have worked too.
* Suppose you were in the middle of downloading, when Wget was
interrupted. Now you do not want to clobber the files already
present. It would be:
wget -nc -r http://www.gnu.org/
* If you want to encode your own username and password to HTTP or
FTP, use the appropriate URL syntax (*note URL Format::).
wget ftp://hniksic:mypassword@unix.server.com/.emacs
* You would like the output documents to go to standard output
instead of to files?
wget -O - http://jagor.srce.hr/ http://www.srce.hr/
You can also combine the two options and make pipelines to
retrieve the documents from remote hotlists:
wget -O - http://cool.list.com/ | wget --force-html -i -
File: wget.info, Node: Very Advanced Usage, Prev: Advanced Usage, Up: Examples
Very Advanced Usage
===================
* If you wish Wget to keep a mirror of a page (or FTP
subdirectories), use `--mirror' (`-m'), which is the shorthand for
`-r -l inf -N'. You can put Wget in the crontab file asking it to
recheck a site each Sunday:
crontab
0 0 * * 0 wget --mirror http://www.gnu.org/ -o /home/me/weeklog
* In addition to the above, you want the links to be converted for
local viewing. But, after having read this manual, you know that
link conversion doesn't play well with timestamping, so you also
want Wget to back up the original HTML files before the
conversion. Wget invocation would look like this:
wget --mirror --convert-links --backup-converted \
http://www.gnu.org/ -o /home/me/weeklog
* But you've also noticed that local viewing doesn't work all that
well when HTML files are saved under extensions other than `.html',
perhaps because they were served as `index.cgi'. So you'd like
Wget to rename all the files served with content-type `text/html'
to `NAME.html'.
wget --mirror --convert-links --backup-converted \
--html-extension -o /home/me/weeklog \
http://www.gnu.org/
Or, with less typing:
wget -m -k -K -E http://www.gnu.org/ -o /home/me/weeklog
File: wget.info, Node: Various, Next: Appendices, Prev: Examples, Up: Top
Various
*******
This chapter contains all the stuff that could not fit anywhere else.
* Menu:
* Proxies:: Support for proxy servers
* Distribution:: Getting the latest version.
* Mailing List:: Wget mailing list for announcements and discussion.
* Reporting Bugs:: How and where to report bugs.
* Portability:: The systems Wget works on.
* Signals:: Signal-handling performed by Wget.
File: wget.info, Node: Proxies, Next: Distribution, Prev: Various, Up: Various
Proxies
=======
"Proxies" are special-purpose HTTP servers designed to transfer data
from remote servers to local clients. One typical use of proxies is
lightening network load for users behind a slow connection. This is
achieved by channeling all HTTP and FTP requests through the proxy
which caches the transferred data. When a cached resource is requested
again, proxy will return the data from cache. Another use for proxies
is for companies that separate (for security reasons) their internal
networks from the rest of Internet. In order to obtain information
from the Web, their users connect and retrieve remote data using an
authorized proxy.
Wget supports proxies for both HTTP and FTP retrievals. The
standard way to specify proxy location, which Wget recognizes, is using
the following environment variables:
`http_proxy'
This variable should contain the URL of the proxy for HTTP
connections.
`ftp_proxy'
This variable should contain the URL of the proxy for FTP
connections. It is quite common that HTTP_PROXY and FTP_PROXY are
set to the same URL.
`no_proxy'
This variable should contain a comma-separated list of domain
extensions proxy should _not_ be used for. For instance, if the
value of `no_proxy' is `.mit.edu', proxy will not be used to
retrieve documents from MIT.
In addition to the environment variables, proxy location and settings
may be specified from within Wget itself.
`-Y on/off'
`--proxy=on/off'
`proxy = on/off'
This option may be used to turn the proxy support on or off. Proxy
support is on by default, provided that the appropriate environment
variables are set.
`http_proxy = URL'
`ftp_proxy = URL'
`no_proxy = STRING'
These startup file variables allow you to override the proxy
settings specified by the environment.
Some proxy servers require authorization to enable you to use them.
The authorization consists of "username" and "password", which must be
sent by Wget. As with HTTP authorization, several authentication
schemes exist. For proxy authorization only the `Basic' authentication
scheme is currently implemented.
You may specify your username and password either through the proxy
URL or through the command-line options. Assuming that the company's
proxy is located at `proxy.company.com' at port 8001, a proxy URL
location containing authorization data might look like this:
http://hniksic:mypassword@proxy.company.com:8001/
Alternatively, you may use the `proxy-user' and `proxy-password'
options, and the equivalent `.wgetrc' settings `proxy_user' and
`proxy_passwd' to set the proxy username and password.
File: wget.info, Node: Distribution, Next: Mailing List, Prev: Proxies, Up: Various
Distribution
============
Like all GNU utilities, the latest version of Wget can be found at
the master GNU archive site prep.ai.mit.edu, and its mirrors. For
example, Wget 1.8.1 can be found at
File: wget.info, Node: Mailing List, Next: Reporting Bugs, Prev: Distribution, Up: Various
Mailing List
============
Wget has its own mailing list at , thanks to
Karsten Thygesen. The mailing list is for discussion of Wget features
and web, reporting Wget bugs (those that you think may be of interest
to the public) and mailing announcements. You are welcome to
subscribe. The more people on the list, the better!
To subscribe, send mail to . the magic
word `subscribe' in the subject line. Unsubscribe by mailing to
.
The mailing list is archived at .
Alternative archive is available at
.
Before actually submitting a bug report, please try to follow a few
simple guidelines.
1. Please try to ascertain that the behaviour you see really is a
bug. If Wget crashes, it's a bug. If Wget does not behave as
documented, it's a bug. If things work strange, but you are not
sure about the way they are supposed to work, it might well be a
bug.
2. Try to repeat the bug in as simple circumstances as possible.
E.g. if Wget crashes while downloading `wget -rl0 -kKE -t5 -Y0
http://yoyodyne.com -o /tmp/log', you should try to see if the
crash is repeatable, and if will occur with a simpler set of
options. You might even try to start the download at the page
where the crash occurred to see if that page somehow triggered the
crash.
Also, while I will probably be interested to know the contents of
your `.wgetrc' file, just dumping it into the debug message is
probably a bad idea. Instead, you should first try to see if the
bug repeats with `.wgetrc' moved out of the way. Only if it turns
out that `.wgetrc' settings affect the bug, mail me the relevant
parts of the file.
3. Please start Wget with `-d' option and send the log (or the
relevant parts of it). If Wget was compiled without debug support,
recompile it. It is _much_ easier to trace bugs with debug support
on.
4. If Wget has crashed, try to run it in a debugger, e.g. `gdb `which
wget` core' and type `where' to get the backtrace.
File: wget.info, Node: Portability, Next: Signals, Prev: Reporting Bugs, Up: Various
Portability
===========
Since Wget uses GNU Autoconf for building and configuring, and avoids
using "special" ultra-mega-cool features of any particular Unix, it
should compile (and work) on all common Unix flavors.
Various Wget versions have been compiled and tested under many kinds
of Unix systems, including Solaris, Linux, SunOS, OSF (aka Digital
Unix), Ultrix, *BSD, IRIX, and others; refer to the file `MACHINES' in
the distribution directory for a comprehensive list. If you compile it
on an architecture not listed there, please let me know so I can update
it.
Wget should also compile on the other Unix systems, not listed in
`MACHINES'. If it doesn't, please let me know.
Thanks to kind contributors, this version of Wget compiles and works
on Microsoft Windows 95 and Windows NT platforms. It has been compiled
successfully using MS Visual C++ 4.0, Watcom, and Borland C compilers,
with Winsock as networking software. Naturally, it is crippled of some
features available on Unix, but it should work as a substitute for
people stuck with Windows. Note that the Windows port is *neither
tested nor maintained* by me--all questions and problems should be
reported to Wget mailing list at where the
maintainers will look at them.
File: wget.info, Node: Signals, Prev: Portability, Up: Various
Signals
=======
Since the purpose of Wget is background work, it catches the hangup
signal (`SIGHUP') and ignores it. If the output was on standard
output, it will be redirected to a file named `wget-log'. Otherwise,
`SIGHUP' is ignored. This is convenient when you wish to redirect the
output of Wget after having started it.
$ wget http://www.ifi.uio.no/~larsi/gnus.tar.gz &
$ kill -HUP %% # Redirect the output to wget-log
Other than that, Wget will not try to interfere with signals in any
way. `C-c', `kill -TERM' and `kill -KILL' should kill it alike.
File: wget.info, Node: Appendices, Next: Copying, Prev: Various, Up: Top
Appendices
**********
This chapter contains some references I consider useful.
* Menu:
* Robots:: Wget as a WWW robot.
* Security Considerations:: Security with Wget.
* Contributors:: People who helped.
File: wget.info, Node: Robots, Next: Security Considerations, Prev: Appendices, Up: Appendices
Robots
======
It is extremely easy to make Wget wander aimlessly around a web site,
sucking all the available data in progress. `wget -r SITE', and you're
set. Great? Not for the server admin.
While Wget is retrieving static pages, there's not much of a problem.
But for Wget, there is no real difference between a static page and the
most demanding CGI. For instance, a site I know has a section handled
by an, uh, "bitchin'" CGI script that converts all the Info files to
HTML. The script can and does bring the machine to its knees without
providing anything useful to the downloader.
For such and similar cases various robot exclusion schemes have been
devised as a means for the server administrators and document authors to
protect chosen portions of their sites from the wandering of robots.
The more popular mechanism is the "Robots Exclusion Standard", or
RES, written by Martijn Koster et al. in 1994. It specifies the format
of a text file containing directives that instruct the robots which URL
paths to avoid. To be found by the robots, the specifications must be
placed in `/robots.txt' in the server root, which the robots are
supposed to download and parse.
Wget supports RES when downloading recursively. So, when you issue:
wget -r http://www.server.com/
First the index of `www.server.com' will be downloaded. If Wget
finds that it wants to download more documents from that server, it will
request `http://www.server.com/robots.txt' and, if found, use it for
further downloads. `robots.txt' is loaded only once per each server.
Until version 1.8, Wget supported the first version of the standard,
written by Martijn Koster in 1994 and available at
. As of version 1.8, Wget
has supported the additional directives specified in the internet draft
`' titled "A Method for Web Robots
Control". The draft, which has as far as I know never made to an RFC,
is available at .
This manual no longer includes the text of the Robot Exclusion
Standard.
The second, less known mechanism, enables the author of an individual
document to specify whether they want the links from the file to be
followed by a robot. This is achieved using the `META' tag, like this:
. Wget supports this
method of robot exclusion in addition to the usual `/robots.txt'
exclusion.
a proxy URL
location containing authorization data might look like this:
http://hniksic:mypassword@proxy.company.com:8001/
Alternatively, you may use the `proxy-user' an./info/wget.info-3 644 0 0 133202 7445172706 7135 This is wget.info, produced by makeinfo version 4.1 from wget.texi.
INFO-DIR-SECTION Net Utilities
INFO-DIR-SECTION World Wide Web
START-INFO-DIR-ENTRY
* Wget: (wget). The non-interactive network downloader.
END-INFO-DIR-ENTRY
This file documents the the GNU Wget utility for downloading network
data.
Copyright (C) 1996, 1997, 1998, 2000, 2001 Free Software Foundation,
Inc.
Permission is granted to make and distribute verbatim copies of this
manual provided the copyright notice and this permission notice are
preserved on all copies.
Permission is granted to copy, distribute and/or modify this document
under the terms of the GNU Free Documentation License, Version 1.1 or
any later version published by the Free Software Foundation; with the
Invariant Sections being "GNU General Public License" and "GNU Free
Documentation License", with no Front-Cover Texts, and with no
Back-Cover Texts. A copy of the license is included in the section
entitled "GNU Free Documentation License".
File: wget.info, Node: Security Considerations, Next: Contributors, Prev: Robots, Up: Appendices
Security Considerations
=======================
When using Wget, you must be aware that it sends unencrypted
passwords through the network, which may present a security problem.
Here are the main issues, and some solutions.
1. The passwords on the command line are visible using `ps'. If this
is a problem, avoid putting passwords from the command line--e.g.
you can use `.netrc' for this.
2. Using the insecure "basic" authentication scheme, unencrypted
passwords are transmitted through the network routers and gateways.
3. The FTP passwords are also in no way encrypted. There is no good
solution for this at the moment.
4. Although the "normal" output of Wget tries to hide the passwords,
debugging logs show them, in all forms. This problem is avoided by
being careful when you send debug logs (yes, even when you send
them to me).
File: wget.info, Node: Contributors, Prev: Security Considerations, Up: Appendices
Contributors
============
GNU Wget was written by Hrvoje Niksic .
However, its development could never have gone as far as it has, were it
not for the help of many people, either with bug reports, feature
proposals, patches, or letters saying "Thanks!".
Special thanks goes to the following people (no particular order):
* Karsten Thygesen--donated system resources such as the mailing
list, web space, and FTP space, along with a lot of time to make
these actually work.
* Shawn McHorse--bug reports and patches.
* Kaveh R. Ghazi--on-the-fly `ansi2knr'-ization. Lots of
portability fixes.
* Gordon Matzigkeit--`.netrc' support.
* Zlatko Calusic, Tomislav Vujec and Drazen Kacar--feature
suggestions and "philosophical" discussions.
* Darko Budor--initial port to Windows.
* Antonio Rosella--help and suggestions, plus the Italian
translation.
* Tomislav Petrovic, Mario Mikocevic--many bug reports and
suggestions.
* Francois Pinard--many thorough bug reports and discussions.
* Karl Eichwalder--lots of help with internationalization and other
things.
* Junio Hamano--donated support for Opie and HTTP `Digest'
authentication.
* The people who provided donations for development, including Brian
Gough.
The following people have provided patches, bug/build reports, useful
suggestions, beta testing services, fan mail and all the other things
that make maintenance so much fun:
Ian Abbott Tim Adam, Adrian Aichner, Martin Baehr, Dieter Baron,
Roger Beeman, Dan Berger, T. Bharath, Paul Bludov, Daniel Bodea, Mark
Boyns, John Burden, Wanderlei Cavassin, Gilles Cedoc, Tim Charron, Noel
Cragg, Kristijan Conkas, John Daily, Andrew Davison, Andrew Deryabin,
Ulrich Drepper, Marc Duponcheel, Damir Dzeko, Alan Eldridge, Aleksandar
Erkalovic, Andy Eskilsson, Christian Fraenkel, Masashi Fujita, Howard
Gayle, Marcel Gerrits, Lemble Gregory, Hans Grobler, Mathieu Guillaume,
Dan Harkless, Herold Heiko, Jochen Hein, Karl Heuer, HIROSE Masaaki,
Gregor Hoffleit, Erik Magnus Hulthen, Richard Huveneers, Jonas Jensen,
Simon Josefsson, Mario Juric, Hack Kampbjorn, Const Kaplinsky, Goran
Kezunovic, Robert Kleine, KOJIMA Haime, Fila Kolodny, Alexander
Kourakos, Martin Kraemer, Simos KSenitellis, Hrvoje Lacko, Daniel S.
Lewart, Nicolas Lichtmeier, Dave Love, Alexander V. Lukyanov, Jordan
Mendelson, Lin Zhe Min, Tim Mooney, Simon Munton, Charlie Negyesi, R.
K. Owen, Andrew Pollock, Steve Pothier, Jan Prikryl, Marin Purgar,
Csaba Raduly, Keith Refson, Tyler Riddle, Tobias Ringstrom, Juan Jose
Rodrigues, Edward J. Sabol, Heinz Salzmann, Robert Schmidt, Andreas
Schwab, Chris Seawood, Toomas Soome, Tage Stabell-Kulo, Sven
Sternberger, Markus Strasser, John Summerfield, Szakacsits Szabolcs,
Mike Thomas, Philipp Thomas, Dave Turner, Russell Vincent, Charles G
Waldman, Douglas E. Wegscheid, Jasmin Zainul, Bojan Zdrnja, Kristijan
Zimmer.
Apologies to all who I accidentally left out, and many thanks to all
the subscribers of the Wget mailing list.
File: wget.info, Node: Copying, Next: Concept Index, Prev: Appendices, Up: Top
Copying
*******
GNU Wget is licensed under the GNU GPL, which makes it "free
software".
Please note that "free" in "free software" refers to liberty, not
price. As some GNU project advocates like to point out, think of "free
speech" rather than "free beer". The exact and legally binding
distribution terms are spelled out below; in short, you have the right
(freedom) to run and change Wget and distribute it to other people, and
even--if you want--charge money for doing either. The important
restriction is that you have to grant your recipients the same rights
and impose the same restrictions.
This method of licensing software is also known as "open source"
because, among other things, it makes sure that all recipients will
receive the source code along with the program, and be able to improve
it. The GNU project prefers the term "free software" for reasons
outlined at
.
The exact license terms are defined by this paragraph and the GNU
General Public License it refers to:
GNU Wget is free software; you can redistribute it and/or modify it
under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2 of the License, or
(at your option) any later version.
GNU Wget is distributed in the hope that it will be useful, but
WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
General Public License for more details.
A copy of the GNU General Public License is included as part of
this manual; if you did not receive it, write to the Free Software
Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
In addition to this, this manual is free in the same sense:
Permission is granted to copy, distribute and/or modify this
document under the terms of the GNU Free Documentation License,
Version 1.1 or any later version published by the Free Software
Foundation; with the Invariant Sections being "GNU General Public
License" and "GNU Free Documentation License", with no Front-Cover
Texts, and with no Back-Cover Texts. A copy of the license is
included in the section entitled "GNU Free Documentation License".
The full texts of the GNU General Public License and of the GNU Free
Documentation License are available below.
* Menu:
* GNU General Public License::
* GNU Free Documentation License::
File: wget.info, Node: GNU General Public License, Next: GNU Free Documentation License, Prev: Copying, Up: Copying
GNU General Public License
==========================
Version 2, June 1991
Copyright (C) 1989, 1991 Free Software Foundation, Inc.
675 Mass Ave, Cambridge, MA 02139, USA
Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed.
Preamble
========
The licenses for most software are designed to take away your
freedom to share and change it. By contrast, the GNU General Public
License is intended to guarantee your freedom to share and change free
software--to make sure the software is free for all its users. This
General Public License applies to most of the Free Software
Foundation's software and to any other program whose authors commit to
using it. (Some other Free Software Foundation software is covered by
the GNU Library General Public License instead.) You can apply it to
your programs, too.
When we speak of free software, we are referring to freedom, not
price. Our General Public Licenses are designed to make sure that you
have the freedom to distribute copies of free software (and charge for
this service if you wish), that you receive source code or can get it
if you want it, that you can change the software or use pieces of it in
new free programs; and that you know you can do these things.
To protect your rights, we need to make restrictions that forbid
anyone to deny you these rights or to ask you to surrender the rights.
These restrictions translate to certain responsibilities for you if you
distribute copies of the software, or if you modify it.
For example, if you distribute copies of such a program, whether
gratis or for a fee, you must give the recipients all the rights that
you have. You must make sure that they, too, receive or can get the
source code. And you must show them these terms so they know their
rights.
We protect your rights with two steps: (1) copyright the software,
and (2) offer you this license which gives you legal permission to copy,
distribute and/or modify the software.
Also, for each author's protection and ours, we want to make certain
that everyone understands that there is no warranty for this free
software. If the software is modified by someone else and passed on, we
want its recipients to know that what they have is not the original, so
that any problems introduced by others will not reflect on the original
authors' reputations.
Finally, any free program is threatened constantly by software
patents. We wish to avoid the danger that redistributors of a free
program will individually obtain patent licenses, in effect making the
program proprietary. To prevent this, we have made it clear that any
patent must be licensed for everyone's free use or not licensed at all.
The precise terms and conditions for copying, distribution and
modification follow.
TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
1. This License applies to any program or other work which contains a
notice placed by the copyright holder saying it may be distributed
under the terms of this General Public License. The "Program",
below, refers to any such program or work, and a "work based on
the Program" means either the Program or any derivative work under
copyright law: that is to say, a work containing the Program or a
portion of it, either verbatim or with modifications and/or
translated into another language. (Hereinafter, translation is
included without limitation in the term "modification".) Each
licensee is addressed as "you".
Activities other than copying, distribution and modification are
not covered by this License; they are outside its scope. The act
of running the Program is not restricted, and the output from the
Program is covered only if its contents constitute a work based on
the Program (independent of having been made by running the
Program). Whether that is true depends on what the Program does.
2. You may copy and distribute verbatim copies of the Program's
source code as you receive it, in any medium, provided that you
conspicuously and appropriately publish on each copy an appropriate
copyright notice and disclaimer of warranty; keep intact all the
notices that refer to this License and to the absence of any
warranty; and give any other recipients of the Program a copy of
this License along with the Program.
You may charge a fee for the physical act of transferring a copy,
and you may at your option offer warranty protection in exchange
for a fee.
3. You may modify your copy or copies of the Program or any portion
of it, thus forming a work based on the Program, and copy and
distribute such modifications or work under the terms of Section 1
above, provided that you also meet all of these conditions:
a. You must cause the modified files to carry prominent notices
stating that you changed the files and the date of any change.
b. You must cause any work that you distribute or publish, that
in whole or in part contains or is derived from the Program
or any part thereof, to be licensed as a whole at no charge
to all third parties under the terms of this License.
c. If the modified program normally reads commands interactively
when run, you must cause it, when started running for such
interactive use in the most ordinary way, to print or display
an announcement including an appropriate copyright notice and
a notice that there is no warranty (or else, saying that you
provide a warranty) and that users may redistribute the
program under these conditions, and telling the user how to
view a copy of this License. (Exception: if the Program
itself is interactive but does not normally print such an
announcement, your work based on the Program is not required
to print an announcement.)
These requirements apply to the modified work as a whole. If
identifiable sections of that work are not derived from the
Program, and can be reasonably considered independent and separate
works in themselves, then this License, and its terms, do not
apply to those sections when you distribute them as separate
works. But when you distribute the same sections as part of a
whole which is a work based on the Program, the distribution of
the whole must be on the terms of this License, whose permissions
for other licensees extend to the entire whole, and thus to each
and every part regardless of who wrote it.
Thus, it is not the intent of this section to claim rights or
contest your rights to work written entirely by you; rather, the
intent is to exercise the right to control the distribution of
derivative or collective works based on the Program.
In addition, mere aggregation of another work not based on the
Program with the Program (or with a work based on the Program) on
a volume of a storage or distribution medium does not bring the
other work under the scope of this License.
4. You may copy and distribute the Program (or a work based on it,
under Section 2) in object code or executable form under the terms
of Sections 1 and 2 above provided that you also do one of the
following:
a. Accompany it with the complete corresponding machine-readable
source code, which must be distributed under the terms of
Sections 1 and 2 above on a medium customarily used for
software interchange; or,
b. Accompany it with a written offer, valid for at least three
years, to give any third party, for a charge no more than your
cost of physically performing source distribution, a complete
machine-readable copy of the corresponding source code, to be
distributed under the terms of Sections 1 and 2 above on a
medium customarily used for software interchange; or,
c. Accompany it with the information you received as to the offer
to distribute corresponding source code. (This alternative is
allowed only for noncommercial distribution and only if you
received the program in object code or executable form with
such an offer, in accord with Subsection b above.)
The source code for a work means the preferred form of the work for
making modifications to it. For an executable work, complete
source code means all the source code for all modules it contains,
plus any associated interface definition files, plus the scripts
used to control compilation and installation of the executable.
However, as a special exception, the source code distributed need
not include anything that is normally distributed (in either
source or binary form) with the major components (compiler,
kernel, and so on) of the operating system on which the executable
runs, unless that component itself accompanies the executable.
If distribution of executable or object code is made by offering
access to copy from a designated place, then offering equivalent
access to copy the source code from the same place counts as
distribution of the source code, even though third parties are not
compelled to copy the source along with the object code.
5. You may not copy, modify, sublicense, or distribute the Program
except as expressly provided under this License. Any attempt
otherwise to copy, modify, sublicense or distribute the Program is
void, and will automatically terminate your rights under this
License. However, parties who have received copies, or rights,
from you under this License will not have their licenses
terminated so long as such parties remain in full compliance.
6. You are not required to accept this License, since you have not
signed it. However, nothing else grants you permission to modify
or distribute the Program or its derivative works. These actions
are prohibited by law if you do not accept this License.
Therefore, by modifying or distributing the Program (or any work
based on the Program), you indicate your acceptance of this
License to do so, and all its terms and conditions for copying,
distributing or modifying the Program or works based on it.
7. Each time you redistribute the Program (or any work based on the
Program), the recipient automatically receives a license from the
original licensor to copy, distribute or modify the Program
subject to these terms and conditions. You may not impose any
further restrictions on the recipients' exercise of the rights
granted herein. You are not responsible for enforcing compliance
by third parties to this License.
8. If, as a consequence of a court judgment or allegation of patent
infringement or for any other reason (not limited to patent
issues), conditions are imposed on you (whether by court order,
agreement or otherwise) that contradict the conditions of this
License, they do not excuse you from the conditions of this
License. If you cannot distribute so as to satisfy simultaneously
your obligations under this License and any other pertinent
obligations, then as a consequence you may not distribute the
Program at all. For example, if a patent license would not permit
royalty-free redistribution of the Program by all those who
receive copies directly or indirectly through you, then the only
way you could satisfy both it and this License would be to refrain
entirely from distribution of the Program.
If any portion of this section is held invalid or unenforceable
under any particular circumstance, the balance of the section is
intended to apply and the section as a whole is intended to apply
in other circumstances.
It is not the purpose of this section to induce you to infringe any
patents or other property right claims or to contest validity of
any such claims; this section has the sole purpose of protecting
the integrity of the free software distribution system, which is
implemented by public license practices. Many people have made
generous contributions to the wide range of software distributed
through that system in reliance on consistent application of that
system; it is up to the author/donor to decide if he or she is
willing to distribute software through any other system and a
licensee cannot impose that choice.
This section is intended to make thoroughly clear what is believed
to be a consequence of the rest of this License.
9. If the distribution and/or use of the Program is restricted in
certain countries either by patents or by copyrighted interfaces,
the original copyright holder who places the Program under this
License may add an explicit geographical distribution limitation
excluding those countries, so that distribution is permitted only
in or among countries not thus excluded. In such case, this
License incorporates the limitation as if written in the body of
this License.
10. The Free Software Foundation may publish revised and/or new
versions of the General Public License from time to time. Such
new versions will be similar in spirit to the present version, but
may differ in detail to address new problems or concerns.
Each version is given a distinguishing version number. If the
Program specifies a version number of this License which applies
to it and "any later version", you have the option of following
the terms and conditions either of that version or of any later
version published by the Free Software Foundation. If the Program
does not specify a version number of this License, you may choose
any version ever published by the Free Software Foundation.
11. If you wish to incorporate parts of the Program into other free
programs whose distribution conditions are different, write to the
author to ask for permission. For software which is copyrighted
by the Free Software Foundation, write to the Free Software
Foundation; we sometimes make exceptions for this. Our decision
will be guided by the two goals of preserving the free status of
all derivatives of our free software and of promoting the sharing
and reuse of software generally.
NO WARRANTY
12. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO
WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE
LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT
WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT
NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND
FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE
QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE
PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY
SERVICING, REPAIR OR CORRECTION.
13. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN
WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY
MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE
LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL,
INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR
INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF
DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU
OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY
OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN
ADVISED OF THE POSSIBILITY OF SUCH DAMAGES.
END OF TERMS AND CONDITIONS
How to Apply These Terms to Your New Programs
=============================================
If you develop a new program, and you want it to be of the greatest
possible use to the public, the best way to achieve this is to make it
free software which everyone can redistribute and change under these
terms.
To do so, attach the following notices to the program. It is safest
to attach them to the start of each source file to most effectively
convey the exclusion of warranty; and each file should have at least
the "copyright" line and a pointer to where the full notice is found.
ONE LINE TO GIVE THE PROGRAM'S NAME AND AN IDEA OF WHAT IT DOES.
Copyright (C) 19YY NAME OF AUTHOR
This program is free software; you can redistribute it and/or
modify it under the terms of the GNU General Public License
as published by the Free Software Foundation; either version 2
of the License, or (at your option) any later version.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with this program; if not, write to the Free Software
Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
Also add information on how to contact you by electronic and paper
mail.
If the program is interactive, make it output a short notice like
this when it starts in an interactive mode:
Gnomovision version 69, Copyright (C) 19YY NAME OF AUTHOR
Gnomovision comes with ABSOLUTELY NO WARRANTY; for details
type `show w'. This is free software, and you are welcome
to redistribute it under certain conditions; type `show c'
for details.
The hypothetical commands `show w' and `show c' should show the
appropriate parts of the General Public License. Of course, the
commands you use may be called something other than `show w' and `show
c'; they could even be mouse-clicks or menu items--whatever suits your
program.
You should also get your employer (if you work as a programmer) or
your school, if any, to sign a "copyright disclaimer" for the program,
if necessary. Here is a sample; alter the names:
Yoyodyne, Inc., hereby disclaims all copyright
interest in the program `Gnomovision'
(which makes passes at compilers) written
by James Hacker.
SIGNATURE OF TY COON, 1 April 1989
Ty Coon, President of Vice
This General Public License does not permit incorporating your
program into proprietary programs. If your program is a subroutine
library, you may consider it more useful to permit linking proprietary
applications with the library. If this is what you want to do, use the
GNU Library General Public License instead of this License.
File: wget.info, Node: GNU Free Documentation License, Prev: GNU General Public License, Up: Copying
GNU Free Documentation License
==============================
Version 1.1, March 2000
Copyright (C) 2000 Free Software Foundation, Inc.
59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed.
0. PREAMBLE
The purpose of this License is to make a manual, textbook, or other
written document "free" in the sense of freedom: to assure everyone
the effective freedom to copy and redistribute it, with or without
modifying it, either commercially or noncommercially. Secondarily,
this License preserves for the author and publisher a way to get
credit for their work, while not being considered responsible for
modifications made by others.
This License is a kind of "copyleft", which means that derivative
works of the document must themselves be free in the same sense.
It complements the GNU General Public License, which is a copyleft
license designed for free software.
We have designed this License in order to use it for manuals for
free software, because free software needs free documentation: a
free program should come with manuals providing the same freedoms
that the software does. But this License is not limited to
software manuals; it can be used for any textual work, regardless
of subject matter or whether it is published as a printed book.
We recommend this License principally for works whose purpose is
instruction or reference.
1. APPLICABILITY AND DEFINITIONS
This License applies to any manual or other work that contains a
notice placed by the copyright holder saying it can be distributed
under the terms of this License. The "Document", below, refers to
any such manual or work. Any member of the public is a licensee,
and is addressed as "you".
A "Modified Version" of the Document means any work containing the
Document or a portion of it, either copied verbatim, or with
modifications and/or translated into another language.
A "Secondary Section" is a named appendix or a front-matter
section of the Document that deals exclusively with the
relationship of the publishers or authors of the Document to the
Document's overall subject (or to related matters) and contains
nothing that could fall directly within that overall subject.
(For example, if the Document is in part a textbook of
mathematics, a Secondary Section may not explain any mathematics.)
The relationship could be a matter of historical connection with
the subject or with related matters, or of legal, commercial,
philosophical, ethical or political position regarding them.
The "Invariant Sections" are certain Secondary Sections whose
titles are designated, as being those of Invariant Sections, in
the notice that says that the Document is released under this
License.
The "Cover Texts" are certain short passages of text that are
listed, as Front-Cover Texts or Back-Cover Texts, in the notice
that says that the Document is released under this License.
A "Transparent" copy of the Document means a machine-readable copy,
represented in a format whose specification is available to the
general public, whose contents can be viewed and edited directly
and straightforwardly with generic text editors or (for images
composed of pixels) generic paint programs or (for drawings) some
widely available drawing editor, and that is suitable for input to
text formatters or for automatic translation to a variety of
formats suitable for input to text formatters. A copy made in an
otherwise Transparent file format whose markup has been designed
to thwart or discourage subsequent modification by readers is not
Transparent. A copy that is not "Transparent" is called "Opaque".
Examples of suitable formats for Transparent copies include plain
ASCII without markup, Texinfo input format, LaTeX input format,
SGML or XML using a publicly available DTD, and
standard-conforming simple HTML designed for human modification.
Opaque formats include PostScript, PDF, proprietary formats that
can be read and edited only by proprietary word processors, SGML
or XML for which the DTD and/or processing tools are not generally
available, and the machine-generated HTML produced by some word
processors for output purposes only.
The "Title Page" means, for a printed book, the title page itself,
plus such following pages as are needed to hold, legibly, the
material this License requires to appear in the title page. For
works in formats which do not have any title page as such, "Title
Page" means the text near the most prominent appearance of the
work's title, preceding the beginning of the body of the text.
2. VERBATIM COPYING
You may copy and distribute the Document in any medium, either
commercially or noncommercially, provided that this License, the
copyright notices, and the license notice saying this License
applies to the Document are reproduced in all copies, and that you
add no other conditions whatsoever to those of this License. You
may not use technical measures to obstruct or control the reading
or further copying of the copies you make or distribute. However,
you may accept compensation in exchange for copies. If you
distribute a large enough number of copies you must also follow
the conditions in section 3.
You may also lend copies, under the same conditions stated above,
and you may publicly display copies.
3. COPYING IN QUANTITY
If you publish printed copies of the Document numbering more than
100, and the Document's license notice requires Cover Texts, you
must enclose the copies in covers that carry, clearly and legibly,
all these Cover Texts: Front-Cover Texts on the front cover, and
Back-Cover Texts on the back cover. Both covers must also clearly
and legibly identify you as the publisher of these copies. The
front cover must present the full title with all words of the
title equally prominent and visible. You may add other material
on the covers in addition. Copying with changes limited to the
covers, as long as they preserve the title of the Document and
satisfy these conditions, can be treated as verbatim copying in
other respects.
If the required texts for either cover are too voluminous to fit
legibly, you should put the first ones listed (as many as fit
reasonably) on the actual cover, and continue the rest onto
adjacent pages.
If you publish or distribute Opaque copies of the Document
numbering more than 100, you must either include a
machine-readable Transparent copy along with each Opaque copy, or
state in or with each Opaque copy a publicly-accessible
computer-network location containing a complete Transparent copy
of the Document, free of added material, which the general
network-using public has access to download anonymously at no
charge using public-standard network protocols. If you use the
latter option, you must take reasonably prudent steps, when you
begin distribution of Opaque copies in quantity, to ensure that
this Transparent copy will remain thus accessible at the stated
location until at least one year after the last time you
distribute an Opaque copy (directly or through your agents or
retailers) of that edition to the public.
It is requested, but not required, that you contact the authors of
the Document well before redistributing any large number of
copies, to give them a chance to provide you with an updated
version of the Document.
4. MODIFICATIONS
You may copy and distribute a Modified Version of the Document
under the conditions of sections 2 and 3 above, provided that you
release the Modified Version under precisely this License, with
the Modified Version filling the role of the Document, thus
licensing distribution and modification of the Modified Version to
whoever possesses a copy of it. In addition, you must do these
things in the Modified Version:
A. Use in the Title Page (and on the covers, if any) a title
distinct from that of the Document, and from those of previous
versions (which should, if there were any, be listed in the
History section of the Document). You may use the same title
as a previous version if the original publisher of that version
gives permission.
B. List on the Title Page, as authors, one or more persons or
entities responsible for authorship of the modifications in the
Modified Version, together with at least five of the principal
authors of the Document (all of its principal authors, if it
has less than five).
C. State on the Title page the name of the publisher of the
Modified Version, as the publisher.
D. Preserve all the copyright notices of the Document.
E. Add an appropriate copyright notice for your modifications
adjacent to the other copyright notices.
F. Include, immediately after the copyright notices, a license
notice giving the public permission to use the Modified Version
under the terms of this License, in the form shown in the
Addendum below.
G. Preserve in that license notice the full lists of Invariant
Sections and required Cover Texts given in the Document's
license notice.
H. Include an unaltered copy of this License.
I. Preserve the section entitled "History", and its title, and add
to it an item stating at least the title, year, new authors, and
publisher of the Modified Version as given on the Title Page.
If there is no section entitled "History" in the Document,
create one stating the title, year, authors, and publisher of
the Document as given on its Title Page, then add an item
describing the Modified Version as stated in the previous
sentence.
J. Preserve the network location, if any, given in the Document for
public access to a Transparent copy of the Document, and
likewise the network locations given in the Document for
previous versions it was based on. These may be placed in the
"History" section. You may omit a network location for a work
that was published at least four years before the Document
itself, or if the original publisher of the version it refers
to gives permission.
K. In any section entitled "Acknowledgements" or "Dedications",
preserve the section's title, and preserve in the section all the
substance and tone of each of the contributor acknowledgements
and/or dedications given therein.
L. Preserve all the Invariant Sections of the Document,
unaltered in their text and in their titles. Section numbers
or the equivalent are not considered part of the section titles.
M. Delete any section entitled "Endorsements". Such a section
may not be included in the Modified Version.
N. Do not retitle any existing section as "Endorsements" or to
conflict in title with any Invariant Section.
If the Modified Version includes new front-matter sections or
appendices that qualify as Secondary Sections and contain no
material copied from the Document, you may at your option
designate some or all of these sections as invariant. To do this,
add their titles to the list of Invariant Sections in the Modified
Version's license notice. These titles must be distinct from any
other section titles.
You may add a section entitled "Endorsements", provided it contains
nothing but endorsements of your Modified Version by various
parties-for example, statements of peer review or that the text has
been approved by an organization as the authoritative definition
of a standard.
You may add a passage of up to five words as a Front-Cover Text,
and a passage of up to 25 words as a Back-Cover Text, to the end
of the list of Cover Texts in the Modified Version. Only one
passage of Front-Cover Text and one of Back-Cover Text may be
added by (or through arrangements made by) any one entity. If the
Document already includes a cover text for the same cover,
previously added by you or by arrangement made by the same entity
you are acting on behalf of, you may not add another; but you may
replace the old one, on explicit permission from the previous
publisher that added the old one.
The author(s) and publisher(s) of the Document do not by this
License give permission to use their names for publicity for or to
assert or imply endorsement of any Modified Version.
5. COMBINING DOCUMENTS
You may combine the Document with other documents released under
this License, under the terms defined in section 4 above for
modified versions, provided that you include in the combination
all of the Invariant Sections of all of the original documents,
unmodified, and list them all as Invariant Sections of your
combined work in its license notice.
The combined work need only contain one copy of this License, and
multiple identical Invariant Sections may be replaced with a single
copy. If there are multiple Invariant Sections with the same name
but different contents, make the title of each such section unique
by adding at the end of it, in parentheses, the name of the
original author or publisher of that section if known, or else a
unique number. Make the same adjustment to the section titles in
the list of Invariant Sections in the license notice of the
combined work.
In the combination, you must combine any sections entitled
"History" in the various original documents, forming one section
entitled "History"; likewise combine any sections entitled
"Acknowledgements", and any sections entitled "Dedications". You
must delete all sections entitled "Endorsements."
6. COLLECTIONS OF DOCUMENTS
You may make a collection consisting of the Document and other
documents released under this License, and replace the individual
copies of this License in the various documents with a single copy
that is included in the collection, provided that you follow the
rules of this License for verbatim copying of each of the
documents in all other respects.
You may extract a single document from such a collection, and
distribute it individually under this License, provided you insert
a copy of this License into the extracted document, and follow
this License in all other respects regarding verbatim copying of
that document.
7. AGGREGATION WITH INDEPENDENT WORKS
A compilation of the Document or its derivatives with other
separate and independent documents or works, in or on a volume of
a storage or distribution medium, does not as a whole count as a
Modified Version of the Document, provided no compilation
copyright is claimed for the compilation. Such a compilation is
called an "aggregate", and this License does not apply to the
other self-contained works thus compiled with the Document, on
account of their being thus compiled, if they are not themselves
derivative works of the Document.
If the Cover Text requirement of section 3 is applicable to these
copies of the Document, then if the Document is less than one
quarter of the entire aggregate, the Document's Cover Texts may be
placed on covers that surround only the Document within the
aggregate. Otherwise they must appear on covers around the whole
aggregate.
8. TRANSLATION
Translation is considered a kind of modification, so you may
distribute translations of the Document under the terms of section
4. Replacing Invariant Sections with translations requires special
permission from their copyright holders, but you may include
translations of some or all Invariant Sections in addition to the
original versions of these Invariant Sections. You may include a
translation of this License provided that you also include the
original English version of this License. In case of a
disagreement between the translation and the original English
version of this License, the original English version will prevail.
9. TERMINATION
You may not copy, modify, sublicense, or distribute the Document
except as expressly provided for under this License. Any other
attempt to copy, modify, sublicense or distribute the Document is
void, and will automatically terminate your rights under this
License. However, parties who have received copies, or rights,
from you under this License will not have their licenses
terminated so long as such parties remain in full compliance.
10. FUTURE REVISIONS OF THIS LICENSE
The Free Software Foundation may publish new, revised versions of
the GNU Free Documentation License from time to time. Such new
versions will be similar in spirit to the present version, but may
differ in detail to address new problems or concerns. See
http://www.gnu.org/copyleft/.
Each version of the License is given a distinguishing version
number. If the Document specifies that a particular numbered
version of this License "or any later version" applies to it, you
have the option of following the terms and conditions either of
that specified version or of any later version that has been
published (not as a draft) by the Free Software Foundation. If
the Document does not specify a version number of this License,
you may choose any version ever published (not as a draft) by the
Free Software Foundation.
ADDENDUM: How to use this License for your documents
====================================================
To use this License in a document you have written, include a copy of
the License in the document and put the following copyright and license
notices just after the title page:
Copyright (C) YEAR YOUR NAME.
Permission is granted to copy, distribute and/or modify this document
under the terms of the GNU Free Documentation License, Version 1.1
or any later version published by the Free Software Foundation;
with the Invariant Sections being LIST THEIR TITLES, with the
Front-Cover Texts being LIST, and with the Back-Cover Texts being LIST.
A copy of the license is included in the section entitled ``GNU
Free Documentation License''.
If you have no Invariant Sections, write "with no Invariant
Sections" instead of saying which ones are invariant. If you have no
Front-Cover Texts, write "no Front-Cover Texts" instead of "Front-Cover
Texts being LIST"; likewise for Back-Cover Texts.
If your document contains nontrivial examples of program code, we
recommend releasing these examples in parallel under your choice of
free software license, such as the GNU General Public License, to
permit their use in free software.
Modified Version.
N. Do not retitle any existing section as "Endorsements" or to
conflict in title with any Invariant Section.
If the Modified Version includes new front-matter sections or
appendices that qualify as Secondary Sections and contain no
material copied from the Document, you may at your option
designate some or all of these sections./info/wget.info-4 644 0 0 23705 7445172707 7125 This is wget.info, produced by makeinfo version 4.1 from wget.texi.
INFO-DIR-SECTION Net Utilities
INFO-DIR-SECTION World Wide Web
START-INFO-DIR-ENTRY
* Wget: (wget). The non-interactive network downloader.
END-INFO-DIR-ENTRY
This file documents the the GNU Wget utility for downloading network
data.
Copyright (C) 1996, 1997, 1998, 2000, 2001 Free Software Foundation,
Inc.
Permission is granted to make and distribute verbatim copies of this
manual provided the copyright notice and this permission notice are
preserved on all copies.
Permission is granted to copy, distribute and/or modify this document
under the terms of the GNU Free Documentation License, Version 1.1 or
any later version published by the Free Software Foundation; with the
Invariant Sections being "GNU General Public License" and "GNU Free
Documentation License", with no Front-Cover Texts, and with no
Back-Cover Texts. A copy of the license is included in the section
entitled "GNU Free Documentation License".
File: wget.info, Node: Concept Index, Prev: Copying, Up: Top
Concept Index
*************
* Menu:
* .html extension: HTTP Options.
* .listing files, removing: FTP Options.
* .netrc: Startup File.
* .wgetrc: Startup File.
* accept directories: Directory-Based Limits.
* accept suffixes: Types of Files.
* accept wildcards: Types of Files.
* append to log: Logging and Input File Options.
* arguments: Invoking.
* authentication: HTTP Options.
* backing up converted files: Recursive Retrieval Options.
* base for relative links in input file: Logging and Input File Options.
* bind() address: Download Options.
* bug reports: Reporting Bugs.
* bugs: Reporting Bugs.
* cache: HTTP Options.
* client IP address: Download Options.
* clobbering, file: Download Options.
* command line: Invoking.
* Content-Length, ignore: HTTP Options.
* continue retrieval: Download Options.
* contributors: Contributors.
* conversion of links: Recursive Retrieval Options.
* cookies: HTTP Options.
* cookies, loading: HTTP Options.
* cookies, saving: HTTP Options.
* copying: Copying.
* cut directories: Directory Options.
* debug: Logging and Input File Options.
* delete after retrieval: Recursive Retrieval Options.
* directories: Directory-Based Limits.
* directories, exclude: Directory-Based Limits.
* directories, include: Directory-Based Limits.
* directory limits: Directory-Based Limits.
* directory prefix: Directory Options.
* dot style: Download Options.
* downloading multiple times: Download Options.
* examples: Examples.
* exclude directories: Directory-Based Limits.
* execute wgetrc command: Basic Startup Options.
* features: Overview.
* filling proxy cache: Recursive Retrieval Options.
* follow FTP links: Recursive Accept/Reject Options.
* following ftp links: FTP Links.
* following links: Following Links.
* force html: Logging and Input File Options.
* free software: Copying.
* ftp time-stamping: FTP Time-Stamping Internals.
* GFDL: Copying.
* globbing, toggle: FTP Options.
* GPL: Copying.
* hangup: Signals.
* header, add: HTTP Options.
* hosts, spanning: Spanning Hosts.
* http password: HTTP Options.
* http referer: HTTP Options.
* http time-stamping: HTTP Time-Stamping Internals.
* http user: HTTP Options.
* ignore length: HTTP Options.
* include directories: Directory-Based Limits.
* incomplete downloads: Download Options.
* incremental updating: Time-Stamping.
* input-file: Logging and Input File Options.
* invoking: Invoking.
* IP address, client: Download Options.
* latest version: Distribution.
* link conversion: Recursive Retrieval Options.
* links: Following Links.
* list: Mailing List.
* loading cookies: HTTP Options.
* location of wgetrc: Wgetrc Location.
* log file: Logging and Input File Options.
* mailing list: Mailing List.
* mirroring: Very Advanced Usage.
* no parent: Directory-Based Limits.
* no warranty: GNU General Public License.
* no-clobber: Download Options.
* nohup: Invoking.
* number of retries: Download Options.
* operating systems: Portability.
* option syntax: Option Syntax.
* output file: Logging and Input File Options.
* overview: Overview.
* page requisites: Recursive Retrieval Options.
* passive ftp: FTP Options.
* pause: Download Options.
* portability: Portability.
* progress indicator: Download Options.
* proxies: Proxies.
* proxy <1>: HTTP Options.
* proxy: Download Options.
* proxy authentication: HTTP Options.
* proxy filling: Recursive Retrieval Options.
* proxy password: HTTP Options.
* proxy user: HTTP Options.
* quiet: Logging and Input File Options.
* quota: Download Options.
* random wait: Download Options.
* recursion: Recursive Retrieval.
* recursive retrieval: Recursive Retrieval.
* redirecting output: Advanced Usage.
* referer, http: HTTP Options.
* reject directories: Directory-Based Limits.
* reject suffixes: Types of Files.
* reject wildcards: Types of Files.
* relative links: Relative Links.
* reporting bugs: Reporting Bugs.
* required images, downloading: Recursive Retrieval Options.
* resume download: Download Options.
* retries: Download Options.
* retries, waiting between: Download Options.
* retrieving: Recursive Retrieval.
* robots: Robots.
* robots.txt: Robots.
* sample wgetrc: Sample Wgetrc.
* saving cookies: HTTP Options.
* security: Security Considerations.
* server maintenance: Robots.
* server response, print: Download Options.
* server response, save: HTTP Options.
* signal handling: Signals.
* spanning hosts: Spanning Hosts.
* spider: Download Options.
* startup: Startup File.
* startup file: Startup File.
* suffixes, accept: Types of Files.
* suffixes, reject: Types of Files.
* symbolic links, retrieving: FTP Options.
* syntax of options: Option Syntax.
* syntax of wgetrc: Wgetrc Syntax.
* tag-based recursive pruning: Recursive Accept/Reject Options.
* time-stamping: Time-Stamping.
* time-stamping usage: Time-Stamping Usage.
* timeout: Download Options.
* timestamping: Time-Stamping.
* tries: Download Options.
* types of files: Types of Files.
* updating the archives: Time-Stamping.
* URL: URL Format.
* URL syntax: URL Format.
* usage, time-stamping: Time-Stamping Usage.
* user-agent: HTTP Options.
* various: Various.
* verbose: Logging and Input File Options.
* wait: Download Options.
* wait, random: Download Options.
* waiting between retries: Download Options.
* Wget as spider: Download Options.
* wgetrc: Startup File.
* wgetrc commands: Wgetrc Commands.
* wgetrc location: Wgetrc Location.
* wgetrc syntax: Wgetrc Syntax.
* wildcards, accept: Types of Files.
* wildcards, reject: Types of Files.
HTTP Options.
* cookies, loading: ./etc/ 755 0 0 0 7445172710 4637 ./etc/wgetrc 644 0 0 7666 7445172710 6161 ###
### Sample Wget initialization file .wgetrc
###
## You can use this file to change the default behaviour of wget or to
## avoid having to type many many command-line options. This file does
## not contain a comprehensive list of commands -- look at the manual
## to find out what you can put into this file.
##
## Wget initialization file can reside in /usr/local/etc/wgetrc
## (global, for all users) or $HOME/.wgetrc (for a single user).
##
## To use the settings in this file, you will have to uncomment them,
## as well as change them, in most cases, as the values on the
## commented-out lines are the default values (e.g. "off").
##
## Global settings (useful for setting up in /usr/local/etc/wgetrc).
## Think well before you change them, since they may reduce wget's
## functionality, and make it behave contrary to the documentation:
##
# You can set retrieve quota for beginners by specifying a value
# optionally followed by 'K' (kilobytes) or 'M' (megabytes). The
# default quota is unlimited.
#quota = inf
# You can lower (or raise) the default number of retries when
# downloading a file (default is 20).
#tries = 20
# Lowering the maximum depth of the recursive retrieval is handy to
# prevent newbies from going too "deep" when they unwittingly start
# the recursive retrieval. The default is 5.
#reclevel = 5
# Many sites are behind firewalls that do not allow initiation of
# connections from the outside. On these sites you have to use the
# `passive' feature of FTP. If you are behind such a firewall, you
# can turn this on to make Wget use passive FTP by default.
#passive_ftp = off
# The "wait" command below makes Wget wait between every connection.
# If, instead, you want Wget to wait only between retries of failed
# downloads, set waitretry to maximum number of seconds to wait (Wget
# will use "linear backoff", waiting 1 second after the first failure
# on a file, 2 seconds after the second failure, etc. up to this max).
waitretry = 10
##
## Local settings (for a user to set in his $HOME/.wgetrc). It is
## *highly* undesirable to put these settings in the global file, since
## they are potentially dangerous to "normal" users.
##
## Even when setting up your own ~/.wgetrc, you should know what you
## are doing before doing so.
##
# Set this to on to use timestamping by default:
#timestamping = off
# It is a good idea to make Wget send your email address in a `From:'
# header with your request (so that server administrators can contact
# you in case of errors). Wget does *not* send `From:' by default.
#header = From: Your Name
# You can set up other headers, like Accept-Language. Accept-Language
# is *not* sent by default.
#header = Accept-Language: en
# You can set the default proxies for Wget to use for http and ftp.
# They will override the value in the environment.
#http_proxy = http://proxy.yoyodyne.com:18023/
#ftp_proxy = http://proxy.yoyodyne.com:18023/
# If you do not want to use proxy at all, set this to off.
#use_proxy = on
# You can customize the retrieval outlook. Valid options are default,
# binary, mega and micro.
#dot_style = default
# Setting this to off makes Wget not download /robots.txt. Be sure to
# know *exactly* what /robots.txt is and how it is used before changing
# the default!
#robots = on
# It can be useful to make Wget wait between connections. Set this to
# the number of seconds you want Wget to wait.
#wait = 0
# You can force creating directory structure, even if a single is being
# retrieved, by setting this to on.
#dirstruct = off
# You can turn on recursive retrieving by default (don't do this if
# you are not sure you know what it means) by setting this to on.
#recursive = off
# To always back up file X as X.orig before converting its links (due
# to -k / --convert-links / convert_links = on having been specified),
# set this variable to on:
#backup_converted = off
# To have Wget follow FTP links from HTML files by default, set this
# to on:
#follow_ftp = off
Copying.
* globbing, toggle: ./share/ 755 0 0 0 7445172711 5167 ./share/locale/ 755 0 0 0 7445172745 6435 ./share/locale/cs/ 755 0 0 0 7445172712 7034 ./share/locale/cs/LC_MESSAGES/ 755 0 0 0 7445172712 10621 ./share/locale/cs/LC_MESSAGES/wget.mo 644 0 0 67045 7445172712 12245 | h i : n E 2 K > 3 % r & ) - . \ & | + ! / * A & l $ . $ 2 ( " [ ~ ? + " ( < e 8 # - Q k , % , & 8 # _ '
2 I - [ < " # F c : ; W r Y $ * # ! +! C! c! 6 ~! ! ! & " $ # :# " [# ! ~# # ) # , # 2 $ 7$ D$ &( 5( K( Z( ' l( ( 4 ( 8 ( )
&) 1) * >) i) y) ) 5, K, 8 ], , , , , ,
- ! - 7 A- y- - - - + - . 1 3 : 4 " =4 = `4 4 ) 4
4 4 4 + 5 > <5 {5 5 5 / 6 . 6 5 6 07 2 K7 3 ~7 " 7 ) 7 7 $ 8 ?8
_8 / m8 8 6 8 8
9 -9 * N9 3 y9 9 * 9 % 9 : >: J: Q: Y: c: k: {: : " : ; 8 ; < < 5 += V a= K = 6 > + ;> g> s> > > > ) > - > ? 0 #? 5 T? " ? # ? ? ? 5 @ 2 7@ & j@ ) @ " @ @ _ @ < YA A A U A . $B SB , oB B B ' B H C ) IC ( sC 5 C C # C D " %D # HD $ lD " D % D ' D E E
F \F |F " F ( F # F G 'G HG $ eG G G ) G H % I " &I F II J 1 J J 0 N N % O ' :O " bO J O & O O 9 wQ 5 Q " Q 1
R ) H 3 a j h X V Z # A | & = O 8 R u g . n ? ^
1 < t
i N Y , e ' ~ y ` I z T : P
[ skipping %dK ]
The file is already fully retrieved; nothing to do.
CTRL+Break received, redirecting output to `%s'.
Execution continued in background.
You may stop Wget by pressing CTRL+ALT+DELETE.
Continued download failed on this file, which conflicts with `-c'.
Refusing to truncate existing file `%s'.
FINISHED --%s--
Downloaded: %s bytes in %d files
Mandatory arguments to long options are mandatory for short options too.
Originally written by Hrvoje Niksic .
REST failed, starting from scratch.
REST failed; will not truncate `%s'.
(%s bytes) (%s to go) (unauthoritative)
[%s to go] [following] %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld]
%s (%s) - `%s' saved [%ld/%ld])
%s (%s) - `%s' saved [%ld]
%s ERROR %d: %s.
%s received, redirecting output to `%%s'.
%s request sent, awaiting response... %s: %s, closing control connection.
%s: %s: Cannot convert `%s' to an IP address.
%s: %s: Invalid specification `%s'.
%s: %s: Not enough memory.
%s: %s: Please specify always, on, off, or never.
%s: %s: Please specify on or off.
%s: %s: invalid command
%s: %s:%d: unknown token "%s"
%s: %s:%d: warning: "%s" token appears before any machine name
%s: BUG: unknown command `%s', value `%s'.
%s: Cannot read %s (%s).
%s: Couldn't find usable socket driver.
%s: Error in %s at line %d.
%s: Invalid specification `%s'
%s: Redirection cycle detected.
%s: Warning: Both system and user wgetrc point to `%s'.
%s: cannot stat %s: %s
%s: corrupt time-stamp.
%s: debug support not compiled in.
%s: illegal option -- %c
%s: illegal option -- `-n%c'
%s: missing URL
%s: option `%c%s' doesn't allow an argument
%s: option `%s' is ambiguous
%s: option `%s' requires an argument
%s: option `--%s' doesn't allow an argument
%s: option requires an argument -- %c
%s: unknown/unsupported file type.
%s: unrecognized option `%c%s'
%s: unrecognized option `--%s'
(no description) (try:%2d) ==> CWD not needed.
==> CWD not required.
Already have correct symlink %s -> %s
Authorization failed.
Bind error (%s).
Can't be verbose and quiet at the same time.
Can't timestamp and not clobber old files at the same time.
Cannot back up %s as %s: %s
Cannot convert links in %s: %s
Cannot initiate PASV transfer.
Cannot open cookies file `%s': %s
Cannot parse PASV response.
Cannot write to `%s' (%s).
Connecting to %s:%hu... Connection to %s:%hu refused.
Continuing in background.
Control connection closed.
Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
Could not find proxy host.
Creating symlink %s -> %s
Data transfer aborted.
Directories:
-nd --no-directories don't create directories.
-x, --force-directories force creation of directories.
-nH, --no-host-directories don't create host directories.
-P, --directory-prefix=PREFIX save files to PREFIX/...
--cut-dirs=NUMBER ignore NUMBER remote directory components.
Directory Download quota (%s bytes) EXCEEDED!
Download:
--bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host.
-t, --tries=NUMBER set number of retries to NUMBER (0 unlimits).
-O --output-document=FILE write documents to FILE.
-nc, --no-clobber don't clobber existing files or use .# suffixes.
-c, --continue resume getting a partially-downloaded file.
--dot-style=STYLE set retrieval display style.
-N, --timestamping don't re-retrieve files unless newer than local.
-S, --server-response print server response.
--spider don't download anything.
-T, --timeout=SECONDS set the read timeout to SECONDS.
-w, --wait=SECONDS wait SECONDS between retrievals.
--waitretry=SECONDS wait 1...SECONDS between retries of a retrieval.
-Y, --proxy=on/off turn proxy on or off.
-Q, --quota=NUMBER set retrieval quota to NUMBER.
ERROR: Redirection (%d) without location.
End of file while parsing headers.
Error closing `%s': %s
Error in Set-Cookie, field `%s' Error in server greeting.
Error in server response, closing control connection.
Error writing to `%s': %s
FTP options:
-nr, --dont-remove-listing don't remove `.listing' files.
-g, --glob=on/off turn file name globbing on or off.
--passive-ftp use the "passive" transfer mode.
--retr-symlinks when recursing, get linked-to files (not dirs).
Failed to get certificate key from %s
Failed to load certificates from %s
Failed to set up an SSL context
Failed to unlink symlink `%s': %s
Failed writing HTTP request: %s.
File File `%s' already there, not retrieving.
File `%s' already there, will not retrieve.
GNU Wget %s, a non-interactive network retriever.
Giving up.
HTTP options:
--http-user=USER set http user to USER.
--http-passwd=PASS set http password to PASS.
-C, --cache=on/off (dis)allow server-cached data (normally allowed).
-E, --html-extension save all text/html documents with .html extension.
--ignore-length ignore `Content-Length' header field.
--header=STRING insert STRING among the headers.
--proxy-user=USER set USER as proxy username.
--proxy-passwd=PASS set PASS as proxy password.
--referer=URL include `Referer: URL' header in HTTP request.
-s, --save-headers save the HTTP headers to file.
-U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION.
--no-http-keep-alive disable HTTP keep-alive (persistent connections).
--cookies=off don't use cookies.
--load-cookies=FILE load cookies from FILE before session.
--save-cookies=FILE save cookies to FILE after session.
Host not found Index of /%s on %s:%d Invalid PORT.
Invalid host name Invalid name of the symlink, skipping.
Invalid port specification Last-modified header invalid -- time-stamp ignored.
Last-modified header missing -- time-stamps turned off.
Length: Length: %s Link Loading robots.txt; please ignore errors.
Location: %s%s
Logged in!
Logging and input file:
-o, --output-file=FILE log messages to FILE.
-a, --append-output=FILE append messages to FILE.
-d, --debug print debug output.
-q, --quiet quiet (no output).
-v, --verbose be verbose (this is the default).
-nv, --non-verbose turn off verboseness, without being quiet.
-i, --input-file=FILE download URLs found in FILE.
-F, --force-html treat input file as HTML.
-B, --base=URL prepends URL to relative links in -F -i file.
--sslcertfile=FILE optional client certificate.
--sslcertkey=KEYFILE optional keyfile for this certificate.
Logging in as %s ... Login incorrect.
Mail bug reports and suggestions to .
Malformed status line No URLs found in %s.
No data received No matches on pattern `%s'.
No such directory `%s'.
No such file `%s'.
No such file or directory `%s'.
Not descending to `%s' as it is excluded/not-included.
Not sure Output will be written to `%s'.
Proxy %s: Must be HTTP.
Read error (%s) in headers.
Recursion depth %d exceeded max. depth %d.
Recursive accept/reject:
-A, --accept=LIST comma-separated list of accepted extensions.
-R, --reject=LIST comma-separated list of rejected extensions.
-D, --domains=LIST comma-separated list of accepted domains.
--exclude-domains=LIST comma-separated list of rejected domains.
--follow-ftp follow FTP links from HTML documents.
--follow-tags=LIST comma-separated list of followed HTML tags.
-G, --ignore-tags=LIST comma-separated list of ignored HTML tags.
-H, --span-hosts go to foreign hosts when recursive.
-L, --relative follow relative links only.
-I, --include-directories=LIST list of allowed directories.
-X, --exclude-directories=LIST list of excluded directories.
-nh, --no-host-lookup don't DNS-lookup hosts.
-np, --no-parent don't ascend to the parent directory.
Recursive retrieval:
-r, --recursive recursive web-suck -- use with care!
-l, --level=NUMBER maximum recursion depth (inf or 0 for infinite).
--delete-after delete files locally after downloading them.
-k, --convert-links convert non-relative links to relative.
-K, --backup-converted before converting file X, back up as X.orig.
-m, --mirror shortcut option equivalent to -r -N -l inf -nr.
-p, --page-requisites get all images, etc. needed to display HTML page.
Rejecting `%s'.
Remote file is newer than local file `%s' -- retrieving.
Remote file is newer, retrieving.
Remote file no newer than local file `%s' -- not retrieving.
Removed `%s'.
Removing %s since it should be rejected.
Removing %s.
Retrying.
Reusing connection to %s:%hu.
Server error, can't determine system type.
Server file no newer than local file `%s' -- not retrieving.
Skipping directory `%s'.
Starting WinHelp %s
Startup:
-V, --version display the version of Wget and exit.
-h, --help print this help.
-b, --background go to background after startup.
-e, --execute=COMMAND execute a `.wgetrc'-style command.
Symlinks not supported, skipping symlink `%s'.
Syntax error in Set-Cookie at character `%c'.
Syntax error in Set-Cookie: premature end of string.
The server refuses login.
The sizes do not match (local %ld) -- retrieving.
The sizes do not match (local %ld) -- retrieving.
Try `%s --help' for more options.
Trying without the specified certificate
Unable to delete `%s': %s
Unable to establish SSL connection.
Unknown authentication scheme.
Unknown error Unknown type `%c', closing control connection.
Unknown/unsupported protocol Unsupported listing type, trying Unix listing parser.
Usage: %s NETRC [HOSTNAME]
Usage: %s [OPTION]... [URL]...
Using `%s' as listing tmp file.
Warning: wildcards not supported in HTTP.
Will not retrieve dirs since depth is %d (max %d).
Will try connecting to %s:%hu.
Write failed, closing control connection.
Wrote HTML-ized index to `%s' [%ld].
Wrote HTML-ized index to `%s'.
connected!
done.
done. done. ignored nothing to do.
time unknown unspecified Project-Id-Version: GNU wget 1.7
POT-Creation-Date: 2001-06-04 19:39+0200
PO-Revision-Date: 2001-06-05 23:19+0200
Last-Translator: Jan Prikryl
Language-Team: Czech
MIME-Version: 1.0
Content-Type: text/plain; charset=iso-8859-2
Content-Transfer-Encoding: 8-bit
[ peskakuje se %dK ]
Soubor je ji pln penesen, nebude se nic dlat.
Stiskli jste CTRL+Break, vstup byl proto pesmrovn do `%s'.
Program pokrauje v bhu na pozad.
Wget lze zastavit stiskem CTRL+ALT+DELETE.
Na peruen stahovn tohoto souboru nelze navzat. Bylo ovem zadno `-c'.
Existujc soubor `%s' tedy radji nebude zkrcen.
KONEC --%s--
Celkem nateno %s bajt v %d souborech
Argumenty, povinn u dlouhch pepna, jsou povinn i pro krtk verze
pepna.
Pvodnm autorem tohto programu je Hrvoje Niki .
Pkaz REST selhal, penos zane od zatku souboru.
Pkaz REST selhal, `%s' nebude zkrceno.
(%s bajt) (%s zbv) (nen smrodatn)
[%s zbv] [nsleduji] %s (%s) - Spojen ukoneno na bajtu %ld. %s (%s) - Spojen ukoneno na bajtu %ld/%ld. %s (%s) - Datov spojen: %s; %s (%s) - Chyba pi ten dat na bajtu %ld (%s). %s (%s) - Chyba pi ten dat na bajtu %ld/%ld (%s). %s (%s) - `%s' uloeno [%ld/%ld]
%s (%s) - `%s' uloeno [%ld/%ld])
%s (%s) - `%s' uloen [%ld]
%s CHYBA %d: %s.
Byl zachycen signl %s, vstup pesmrovn do `%%s'.
%s poadavek odesln, program ek na odpov ... %s: %s, dic spojen bude ukoneno.
%s: %s: `%s' nelze pevst na IP adresu.
%s: %s: Neplatn specifikace `%s'
%s: %s: Nen dost pamti.
%s: %s: Zadejte prosm `always' (vdy), `on' (zapnuto), `off' (vypnuto), nebo `never' (nikdy).
%s: %s: Zadejte prosm `on' (zapnuto) nebo `off' (vypnuto).
%s: %s: neplatn pkaz
%s: %s:%d: neznm token "%s"
%s: %s:%d varovn: token "%s" je uveden jet ped jakmkoliv
nzvem potae
%s: CHYBA: Neznm pkaz `%s', hodnota `%s'.
%s: Nelze pest %s (%s).
%s: Nelze najt pouiteln ovlada socket.
%s: Chyba v %s na dku %d.
%s: Neplatn specifikace `%s'
%s: Detekovno zacyklen pesmrovn.
%s: Varovn: Globln i uivatelsk wgetrc jsou shodn uloeny v `%s'.
%s: voln `stat %s' skonilo chybou: %s
%s: asov raztko souboru je poruen.
%s: program nebyl zkompilovn s podporou pro ladn.
%s: neppustn pepna -- %c
%s: neppustn pepna -- `-n%c'
%s: chyb URL
%s: pepna `%c%s' nem argument
%s: pepna `%s' nen jednoznan
%s: pepna `%s' vyaduje argument
%s: pepna `--%s' nem argument
%s: pepna vyaduje argument -- %c
%s: neznm/nepodporovan typ souboru.
%s: neznm pepna `%c%s'
%s: neznm pepna `--%s'
(dn popis) (pokus:%2d) ==> CWD nen poteba.
==> CWD nen poteba.
Korektn symbolick odkaz %s -> %s ji existuje.
Autorizace selhala.
Chyba pi operaci "bind" (%s).
Program neme bt upovdan a zitcha najednou.
Nelze pouvat asov raztka a nemazat pitom star soubory.
Nelze zlohovat %s jako %s: %s
Nelze pevst odkazy v %s: %s
Nelze spustit pasivn penos dat.
Nelze otevt soubor s kolky `%s': %s
Odpov na PASV nen pochopiteln.
Nelze zapsat do `%s' (%s).
Navazuje se spojen s %s:%hu... Spojen s %s:%hu odmtnuto.
Program pokrauje v bhu na pozad.
dic spojen bylo ukoneno.
Pevd se %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc.
Tento program je en v nadji, e bude uiten, avak
BEZ JAKKOLI ZRUKY; neposkytuj se ani odvozen zruky PRODEJNOSTI
anebo VHODNOSTI PRO URIT EL. Dal podrobnosti hledejte
v Obecn veejn licenci GNU.
Nelze najt proxy server.
Vytv se symbolick odkaz %s -> %s
Penos dat byl pedasn ukonen.
Adrese:
-nd --no-directories nevytv adrese
-x, --force-directories vdy vytv adrese
-nH, --no-host-directories nevytv adrese s adresou serveru
-P, --directory-prefix=PREFIX ukld data do PREFIX/...
--cut-dirs=POET nevytv prvnch POET podadres
Adres Pekroen limit objemu uloench dat (%s bajt)!
Stahovn:
--bind-address=ADRESA pouij lokln rozhran s danou adresou (IP nebo jmno)
-t, --tries=SLO poet pokus sthnout URL (0 donekonena)
-O --output-document=SOUBOR staen dokumenty ukld do tohoto souboru
-nc, --no-clobber nepepisuje existujc soubory
-c, --continue pokrauje ve stahovn sten penesench dat
--dot-style=STYL nastav zpsob zobrazen pi stahovn dat
-N, --timestamping nestahuje star soubory (zapne asov raztka)
-S, --server-response vypisuje odpovdi serveru
--spider nic nestahuje
-T, --timeout=SEKUNDY nastav timeout pi ten na tuto hodnotu
-w, --wait=POET ped kadm stahovnm pok POET sekund
--waitretry=POET ek 1...POET sec ped novm pokusem o staen
-Y, --proxy=on/off zapne penos pes proxy (standardn `off')
-Q, --quota=BAJT nastav limit objemu uloench dat
CHYBA: Pesmrovn (%d) bez udan nov adresy.
Hlavika nen pln.
Pi uzavrn `%s' nastala chyba: %s
Chyba v hlavice Set-Cookie v poli `%s' vodn odpov serveru je chybn.
dic spojen bude ukoneno, protoe server odpovdl chybovm hlenm.
Pi zpisu do `%s' nastala chyba: %s.
Pepnae pro FTP protokol:
-nr, --dont-remove-listing nemae soubory `.listing' s obsahy adres
-g, --glob=on/off zapne i vypne expanzi olk ve jmnech soubor
--passive-ftp pouije pasivn md penosu dat
--retr-symlinks v rekurzivnm mdu stahuje i symbolick odkazy na
soubory (nikoliv na adrese)
Ze souboru `%s' nebylo mon kl k certifiktu nast.
SSL certifikty nebylo mon ze souboru `%s' nast.
Nebylo mon nastavit SSL kontext
Nebylo mon odstranit symbolick odkaz `%s': %s
Nebylo mon odeslat HTTP poadavek: %s.
Soubor Soubor `%s' je ji zde a nen jej teba penet.
Soubor `%s' je ji zde a nebude se znovu penet.
GNU Wget %s, program pro neinteraktivn stahovn soubor.
Ani posledn pokus nebyl spn.
Pepnae pro HTTP:
--http-user=UIVATEL uivatelsk jmno pro autorizovan HTTP penos
--http-passwd=HESLO heslo pro autorizovan HTTP penos
-C, --cache=on/off povol i zake pouit vyrovnvac pamti na
stran serveru (implicitn `on')
-E, --html-extension ulo dokumenty typu `text/html' s pponou .html
--ignore-length ignoruje pole `Content-Length' v hlavice
--header=ETZEC pole ETZEC serveru jako soust hlaviek
--proxy-user=UIVATEL jmno uivatele vyadovan pro proxy penos
--proxy-passwd=HESLO heslo pro proxy penos
--referer=URL posl v hlavicce HTTP poadavku `Referer: URL'
-s, --save-headers do stahovanho souboru ulo i hlaviky HTTP
-U, --user-agent=AGENT msto identifikace `Wget/VERZE' posl v hlavice
HTTP poadavku identifikan etzec AGENT
--no-http-keep-alive vypne HTTP keep-alive (trval spojen se serverem)
--cookies=off nebude pouvat kolky (HTTP cookies)
--load-cookies=SOUBOR ped sezenm nate kolky ze souboru SOUBOR
--save-cookies=SOUBOR po sezen ulo kolky do souboru SOUBOR
Pota nebyl nalezen Obsah /%s na %s:%d Neplatn PORT.
Neplatn jmno stroje Peskakuje se symbolick odkaz, nebo nzev odkazu nen platn.
Neplatn specifikace portu asov raztko souboru (`time-stamp') bude ignorovno, protoe hlavika
"Last-modified" obsahuje neplatn daje.
Nelze pout asov raztka (`time-stamps'), protoe v odpovdi serveru
schz hlavika "Last-modified".
Dlka: Dlka: %s Sym. odkaz Nat se `robots.txt'. Chybov hlen ignorujte, prosm.
Pesmrovno na: %s%s
Pihleno!
Protokolovn a vstupn soubor:
-o, --output-file=SOUBOR nzev souboru s protokolem
-a, --append-output=SOUBOR protokol se pipoj na konec tohoto souboru
-d, --debug vypisuje ladic informace
-q, --quiet nevypisuje vbec nic
-v, --verbose bude upovdan (implicitn zapnuto)
-nv, --non-verbose vypisuje pouze nejdleitj informace
-i, --input-file=SOUBOR vchoz URL odkazy nate z tohoto souboru
-F, --force-html soubor s URL je v HTML formtu
-B, --base=URL pid URL na zatky relat. odkaz pi '-F -i'
--sslcertfile=SOUBOR voliteln certifikt klienta
--sslcertkey=SOUBOR voliteln soubor kl pro tento certifikt
Probh pihlaovn jako %s ... Chyba pi pihlen.
Zprvy o chybch a nvrhy na vylepen programu zaslejte na adresu
(pouze anglicky).
Komente k eskmu pekladu zaslejte na adresu .
Odpov serveru m zkomolen stavov dek V souboru `%s' nebyla nalezena dn URL.
Nepila dn data Vzorku `%s' nic neodpovd.
Adres `%s' neexistuje.
Soubor `%s' neexistuje.
Soubor i adres `%s' neexistuje.
Do adrese `%s' se nesetupuje, protoe tento adres se bu m vynechat nebo
nebyl zadn k prochzen.
Neznm typ Vstup bude zapsn do `%s'.
Proxy %s: Mus bt HTTP.
Chyba (%s) pi ten hlaviek.
Hloubka rekurze %d pekroila maximln hloubku %d.
Omezen pi rekurzi:
-A, --accept=SEZNAM seznam povolench extenz soubor
-R, --reject=SEZNAM seznam nepovolench extenz soubor
-D, --domains=SEZNAM seznam povolench domn
--exclude-domains=SEZNAM seznam nepovolench domn
--follow-ftp nsleduje FTP odkazy v HTML dokumentech
--follow-tags=LIST seznam nsledovanch HTML znaek
-G, --ignore-tags=LIST seznam ignorovanch HTML znaek
-H, --span-hosts nat dokumenty i z ostatnch server
-I, --include-directories=SEZNAM seznam povolench adres
-L, --relative nsleduje pouze relativn odkazy
-X, --exclude-directories=SEZNAM seznam vylouench adres
-nh, --no-host-lookup nevyhledv adresy v DNS
-np, --no-parent nesestupuje do rodiovskho adrese
Rekurzivn stahovn:
-r, --recursive rekurzivn stahovn -- bute opatrn!
-l, --level=SLO maximln hloubka rekurze (0 bez limitu)
--delete-after po penosu smae staen soubory
-k, --convert-links absolutn URL pevee na relativn
-K, --backup-converted ped konverz ulo `X' jako `X.orig'
-m, --mirror zapne pepnae vhodn pro zrcadlen dat
-p, --page-requisites sthne ve nutn pro zobrazen HTML strnky
Soubor `%s' se nem stahovat.
Vzdlen soubor je novj, ne lokln soubor `%s', a je jej teba sthnout.
Lokln soubor je star a vzdlen soubor se proto bude penet.
Vzdlen soubor nen novj, ne lokln soubor `%s', a nen jej teba stahovat.
Soubor `%s' byl vymazn.
Mae se %s, protoe tento soubor nen poadovn.
Mae se %s.
Zkus se to znovu.
Program vyuije existujc spojen s %s:%hu.
Nelze zjistit typ vzdlenho operanho systmu, protoe server odpovdl chybovm hlenm.
Lokln soubor `%s' nen star, ne vzdlen soubor, a nen jej teba stahovat.
Adres `%s' bude vynechn.
Spout se WinHelp %s
Zatek:
-V, --version vype informaci o verzi programu Wget a skon
-h, --help vype tuto npovdu
-b, --background po sputn pokrauje program v bhu na pozad
-e, --execute=PKAZ provee pkaz zadan ve stylu `.wgetrc'
Symbolick odkaz `%s' bude vynechn, protoe systm symbolick odkazy nepodporuje.
Syntaktick chyba v hlavice Set-Cookie na znaku `%c'.
Syntaktick chyba v hlavice Set-Cookie: Pedasn konec etzce.
Server odmt pihlen.
Velikosti se neshoduj (lokln %ld), soubor je teba sthnout.
Velikosti se neshoduj (lokln %ld), soubor je teba sthnout.
Pkaz `%s --help' vype vznam platnch pepna.
Program se pokus pokraovat bez zadanho certifiktu.
Nebylo mon odstranit `%s': %s
Nebylo mon navzat SSL spojen.
Server poaduje neznm zpsob autentifikace.
Neznm chyba Rdic spojen bude ukoneno, protoe je poadovn neznm typ penosu `%c'.
Neznm/nepodporovan protokol Nepodporovan typ vpisu, pouije se Unixov parser.
Pouit: %s NETRC [NZEV POTAE]
Pouit: %s [PEPNA]... [URL]...
Seznam soubor bude doasn uloen v `%s'.
Varovn: HTTP nepodporuje olkov znaky.
Podadrese se nebudou penet, protoe ji bylo dosaeno hloubky %d (maximum je %d).
Program se pokus spojit s %s:%hu.
Rdic spojen bude ukoneno, protoe nelze zapsat data.
Vpis adrese v HTML formtu byl zapsn do `%s' [%ld].
Vpis adrese v HTML formtu byl zapsn do `%s'.
spojeno!
hotovo.
hotovo. hotovo. je ignorovna nic nen poteba pevdt.
as neznm neudno novm pokusem o staen
-Y, --proxy=on/off zapne penos pes proxy (standardn `off')
-Q, --quota=BAJT nastav limit objemu uloench dat
CHYBA: Pesmrovn (%d) bez udan nov adresy.
Hlavika nen pln.
Pi uzavrn `%s' nastala chyba: %s
Chyba v hlavice Set-Cookie v poli `%s' vodn odpov serveru je chybn.
dic spojen bude ukoneno, protoe server odpovdl chybovm hlenm.
Pi zpisu do `%s' nastala chyba: %s.
Pepnae./share/locale/da/ 755 0 0 0 7445172713 7014 ./share/locale/da/LC_MESSAGES/ 755 0 0 0 7445172713 10601 ./share/locale/da/LC_MESSAGES/wget.mo 644 0 0 64374 7445172713 12227 | h i : n E 2 K > 3 % r & ) - . \ & | + ! / * A & l $ . $ 2 ( " [ ~ ? + " ( < e 8 # - Q k , % , & 8 # _ '
2 I - [ < " # F c : ; W r Y $ * # ! +! C! c! 6 ~! ! ! & " $ # :# " [# ! ~# # ) # , # 2 $ 7$ D$ &( 5( K( Z( ' l( ( 4 ( 8 ( )
&) 1) * >) i) y) ) 5, K, 8 ], , , , , ,
- ! - 7 A- y- - - - + - . 1 3 : 4 " =4 = `4 4 ) 4
4 4 4 + 5 > <5 {5 5 5 / 6 . 6 5 6 07 2 K7 3 ~7 " 7 ) 7 7 $ 8 ?8
_8 / m8 8 6 8 8
9 -9 * N9 3 y9 9 * 9 % 9 : >: J: Q: Y: c: k: {: : . : ; B ; ,< y < - 1= L _= ? = = *
>
8>
C> Q>
f> t> + > / > > % > ) %? O? o? ? ? / ? ( ? $ @ 1 :@ # l@ @ < @ ) @ A /A : NA , A A ' A A B 6B @ UB B B E B C /C LC + ^C C # C + C $ C * D HD `D xD D D D - D D E / $E M TE ) E $ E " E ! F $ 6F [F {F F F F F F H (H GH w `H I # I J ' M 0 N KN iN " N 4 N N . O % /P ' UP }P - P - P P , Q 7 4Q 3 lQ Q ; Q U U V V - 8V fV 9 V : V V
W W 5 W RW ^W kW &Z =Z 7 SZ Z Z Z $ Z Z [ ( 4[ ; ][ [ # [ ! [ [ 0 \ :\ . _ (b 0 9b ! jb 7 b b % b b c " c * 8c 8 cc c c c 4 d * d 8 e # Ve 2 ze 2 e ! e # f &f % @f ff f . f ' f A f +g Gg * dg . g 0 g g 0 h - ?h ' mh h h h
h h h h
h f d o ( Q 2 L * C _ x w " K v p D 6 - E F 9 b 5 $ M / s S ; ! J l } k + U B 7 [ % 0 G \ r @ { W c m ] 4 ) q > H 3 a j h X V Z # A | & = O 8 R u g . n ? ^
1 < t
i N Y , e ' ~ y ` I z T : P
[ skipping %dK ]
The file is already fully retrieved; nothing to do.
CTRL+Break received, redirecting output to `%s'.
Execution continued in background.
You may stop Wget by pressing CTRL+ALT+DELETE.
Continued download failed on this file, which conflicts with `-c'.
Refusing to truncate existing file `%s'.
FINISHED --%s--
Downloaded: %s bytes in %d files
Mandatory arguments to long options are mandatory for short options too.
Originally written by Hrvoje Niksic .
REST failed, starting from scratch.
REST failed; will not truncate `%s'.
(%s bytes) (%s to go) (unauthoritative)
[%s to go] [following] %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld]
%s (%s) - `%s' saved [%ld/%ld])
%s (%s) - `%s' saved [%ld]
%s ERROR %d: %s.
%s received, redirecting output to `%%s'.
%s request sent, awaiting response... %s: %s, closing control connection.
%s: %s: Cannot convert `%s' to an IP address.
%s: %s: Invalid specification `%s'.
%s: %s: Not enough memory.
%s: %s: Please specify always, on, off, or never.
%s: %s: Please specify on or off.
%s: %s: invalid command
%s: %s:%d: unknown token "%s"
%s: %s:%d: warning: "%s" token appears before any machine name
%s: BUG: unknown command `%s', value `%s'.
%s: Cannot read %s (%s).
%s: Couldn't find usable socket driver.
%s: Error in %s at line %d.
%s: Invalid specification `%s'
%s: Redirection cycle detected.
%s: Warning: Both system and user wgetrc point to `%s'.
%s: cannot stat %s: %s
%s: corrupt time-stamp.
%s: debug support not compiled in.
%s: illegal option -- %c
%s: illegal option -- `-n%c'
%s: missing URL
%s: option `%c%s' doesn't allow an argument
%s: option `%s' is ambiguous
%s: option `%s' requires an argument
%s: option `--%s' doesn't allow an argument
%s: option requires an argument -- %c
%s: unknown/unsupported file type.
%s: unrecognized option `%c%s'
%s: unrecognized option `--%s'
(no description) (try:%2d) ==> CWD not needed.
==> CWD not required.
Already have correct symlink %s -> %s
Authorization failed.
Bind error (%s).
Can't be verbose and quiet at the same time.
Can't timestamp and not clobber old files at the same time.
Cannot back up %s as %s: %s
Cannot convert links in %s: %s
Cannot initiate PASV transfer.
Cannot open cookies file `%s': %s
Cannot parse PASV response.
Cannot write to `%s' (%s).
Connecting to %s:%hu... Connection to %s:%hu refused.
Continuing in background.
Control connection closed.
Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
Could not find proxy host.
Creating symlink %s -> %s
Data transfer aborted.
Directories:
-nd --no-directories don't create directories.
-x, --force-directories force creation of directories.
-nH, --no-host-directories don't create host directories.
-P, --directory-prefix=PREFIX save files to PREFIX/...
--cut-dirs=NUMBER ignore NUMBER remote directory components.
Directory Download quota (%s bytes) EXCEEDED!
Download:
--bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host.
-t, --tries=NUMBER set number of retries to NUMBER (0 unlimits).
-O --output-document=FILE write documents to FILE.
-nc, --no-clobber don't clobber existing files or use .# suffixes.
-c, --continue resume getting a partially-downloaded file.
--dot-style=STYLE set retrieval display style.
-N, --timestamping don't re-retrieve files unless newer than local.
-S, --server-response print server response.
--spider don't download anything.
-T, --timeout=SECONDS set the read timeout to SECONDS.
-w, --wait=SECONDS wait SECONDS between retrievals.
--waitretry=SECONDS wait 1...SECONDS between retries of a retrieval.
-Y, --proxy=on/off turn proxy on or off.
-Q, --quota=NUMBER set retrieval quota to NUMBER.
ERROR: Redirection (%d) without location.
End of file while parsing headers.
Error closing `%s': %s
Error in Set-Cookie, field `%s' Error in server greeting.
Error in server response, closing control connection.
Error writing to `%s': %s
FTP options:
-nr, --dont-remove-listing don't remove `.listing' files.
-g, --glob=on/off turn file name globbing on or off.
--passive-ftp use the "passive" transfer mode.
--retr-symlinks when recursing, get linked-to files (not dirs).
Failed to get certificate key from %s
Failed to load certificates from %s
Failed to set up an SSL context
Failed to unlink symlink `%s': %s
Failed writing HTTP request: %s.
File File `%s' already there, not retrieving.
File `%s' already there, will not retrieve.
GNU Wget %s, a non-interactive network retriever.
Giving up.
HTTP options:
--http-user=USER set http user to USER.
--http-passwd=PASS set http password to PASS.
-C, --cache=on/off (dis)allow server-cached data (normally allowed).
-E, --html-extension save all text/html documents with .html extension.
--ignore-length ignore `Content-Length' header field.
--header=STRING insert STRING among the headers.
--proxy-user=USER set USER as proxy username.
--proxy-passwd=PASS set PASS as proxy password.
--referer=URL include `Referer: URL' header in HTTP request.
-s, --save-headers save the HTTP headers to file.
-U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION.
--no-http-keep-alive disable HTTP keep-alive (persistent connections).
--cookies=off don't use cookies.
--load-cookies=FILE load cookies from FILE before session.
--save-cookies=FILE save cookies to FILE after session.
Host not found Index of /%s on %s:%d Invalid PORT.
Invalid host name Invalid name of the symlink, skipping.
Invalid port specification Last-modified header invalid -- time-stamp ignored.
Last-modified header missing -- time-stamps turned off.
Length: Length: %s Link Loading robots.txt; please ignore errors.
Location: %s%s
Logged in!
Logging and input file:
-o, --output-file=FILE log messages to FILE.
-a, --append-output=FILE append messages to FILE.
-d, --debug print debug output.
-q, --quiet quiet (no output).
-v, --verbose be verbose (this is the default).
-nv, --non-verbose turn off verboseness, without being quiet.
-i, --input-file=FILE download URLs found in FILE.
-F, --force-html treat input file as HTML.
-B, --base=URL prepends URL to relative links in -F -i file.
--sslcertfile=FILE optional client certificate.
--sslcertkey=KEYFILE optional keyfile for this certificate.
Logging in as %s ... Login incorrect.
Mail bug reports and suggestions to .
Malformed status line No URLs found in %s.
No data received No matches on pattern `%s'.
No such directory `%s'.
No such file `%s'.
No such file or directory `%s'.
Not descending to `%s' as it is excluded/not-included.
Not sure Output will be written to `%s'.
Proxy %s: Must be HTTP.
Read error (%s) in headers.
Recursion depth %d exceeded max. depth %d.
Recursive accept/reject:
-A, --accept=LIST comma-separated list of accepted extensions.
-R, --reject=LIST comma-separated list of rejected extensions.
-D, --domains=LIST comma-separated list of accepted domains.
--exclude-domains=LIST comma-separated list of rejected domains.
--follow-ftp follow FTP links from HTML documents.
--follow-tags=LIST comma-separated list of followed HTML tags.
-G, --ignore-tags=LIST comma-separated list of ignored HTML tags.
-H, --span-hosts go to foreign hosts when recursive.
-L, --relative follow relative links only.
-I, --include-directories=LIST list of allowed directories.
-X, --exclude-directories=LIST list of excluded directories.
-nh, --no-host-lookup don't DNS-lookup hosts.
-np, --no-parent don't ascend to the parent directory.
Recursive retrieval:
-r, --recursive recursive web-suck -- use with care!
-l, --level=NUMBER maximum recursion depth (inf or 0 for infinite).
--delete-after delete files locally after downloading them.
-k, --convert-links convert non-relative links to relative.
-K, --backup-converted before converting file X, back up as X.orig.
-m, --mirror shortcut option equivalent to -r -N -l inf -nr.
-p, --page-requisites get all images, etc. needed to display HTML page.
Rejecting `%s'.
Remote file is newer than local file `%s' -- retrieving.
Remote file is newer, retrieving.
Remote file no newer than local file `%s' -- not retrieving.
Removed `%s'.
Removing %s since it should be rejected.
Removing %s.
Retrying.
Reusing connection to %s:%hu.
Server error, can't determine system type.
Server file no newer than local file `%s' -- not retrieving.
Skipping directory `%s'.
Starting WinHelp %s
Startup:
-V, --version display the version of Wget and exit.
-h, --help print this help.
-b, --background go to background after startup.
-e, --execute=COMMAND execute a `.wgetrc'-style command.
Symlinks not supported, skipping symlink `%s'.
Syntax error in Set-Cookie at character `%c'.
Syntax error in Set-Cookie: premature end of string.
The server refuses login.
The sizes do not match (local %ld) -- retrieving.
The sizes do not match (local %ld) -- retrieving.
Try `%s --help' for more options.
Trying without the specified certificate
Unable to delete `%s': %s
Unable to establish SSL connection.
Unknown authentication scheme.
Unknown error Unknown type `%c', closing control connection.
Unknown/unsupported protocol Unsupported listing type, trying Unix listing parser.
Usage: %s NETRC [HOSTNAME]
Usage: %s [OPTION]... [URL]...
Using `%s' as listing tmp file.
Warning: wildcards not supported in HTTP.
Will not retrieve dirs since depth is %d (max %d).
Will try connecting to %s:%hu.
Write failed, closing control connection.
Wrote HTML-ized index to `%s' [%ld].
Wrote HTML-ized index to `%s'.
connected!
done.
done. done. ignored nothing to do.
time unknown unspecified Project-Id-Version: wget 1.7.1-pre1
POT-Creation-Date: 2001-06-03 15:27+0200
PO-Revision-Date: 2001-10-26 19:53-0200
Last-Translator: Keld Jrn Simonsen
Language-Team: Danish
MIME-Version: 1.0
Content-Type: text/plain; charset=iso-8859-1
Content-Transfer-Encoding: 8bit
[ hopper over %dK ]
Filen er allerede fuldt overfrt; ingen handling ndvendig.
CTRL+Break modtaget, omdirigerer udskrifter til `%s'.
Krsel fortstter i baggrunden.
Du kan stoppe Wget ved at trykke CTRL+ALT+DELETE.
Fortsat hentning mislykkedes for denne fil, hvilket er i modstning til '-c'.
Ngter at afkorte eksisterende fil '%s'.
FRDIG --%s--
Nedhentede %s byte i %d filer
Obligatoriske argumenter til lange flag er obligatoriske ogs
for korte.
Oprindeligt skrevet af Hrvoje Niksic .
Fejl ved REST, starter forfra.
REST mislykkedes; vil ikke afkorte '%s'.
(%s byte) (%s tilbage) (ikke endegyldigt)
[%s tilbage] [omdirigeret] %s (%s) - Forbindelse lukket ved byte %ld. %s (%s) - Forbindelse lukket ved byte %ld/%ld. %s (%s) - dataforbindelse: %s; %s (%s) - Lsefejl ved byte %ld (%s). %s (%s) - Lsefejl ved byte %ld/%ld (%s). %s (%s) - '%s' gemt [%ld/%ld]
%s (%s) - '%s' gemt [%ld/%ld]
%s (%s) - '%s' gemt [%ld]
%s FEJL %d: %s.
%s modtaget, omdirigerer udskrifter til '%%s'.
%s foresprgsel sendt, afventer svar... %s: %s, lukker kontrolforbindelsen.
%s: %s: Kan ikke omforme '%s' til en IP-adresse.
%s: %s: Ugyldig specifikation '%s'
%s: %s: Ikke nok hukommelse.
%s: %s: Venligst angiv 'always', 'on' 'off', eller 'never'.
%s: %s: Venligst angiv 'on' eller 'off'.
%s: %s: ugyldig kommando
%s: %s:%d: ukendt symbol '%s'
%s: %s:%d: Advarsel: symbolet '%s' fundet fr server-navn
%s: FEJL: Ukendt kommando '%s', vrdi '%s'.
%s: Kan ikke lse %s (%s).
%s: Fandt ingen brugbar sokkel-driver.
%s: Fejl i %s p linje %d.
%s: Ugyldig specifikation '%s'
%s: Omdirigerer lber i ring.
%s: Advarsel: Bde systemets og brugerens wgetrc peger p '%s'.
%s: 'stat' fejlede for %s: %s
%s: ugyldigt tidsstempel.
%s: understttelse for fejlsgning ikke inkluderet ved oversttelse.
%s: ugyldigt flag -- %c
%s: ugyldigt flag -- '-n%c'
%s: URL mangler.
%s: flaget '%c%s' tillader ikke argumenter
%s: flaget '%s' er flertydig
%s: flaget '%s' krver et argument
%s: flaget '--%s' tillader ikke argumenter
%s: flaget krver et argument -- %c
%s: filtypen er ukendt/ikke understttet.
%s: ukendt flag '%c%s'
%s: ukendt flag '--%s'
(ingen beskrivelse) (forsg:%2d) ==> CWD ikke ndvendig.
==> CWD ikke ndvendig.
Har allerede gyldig symbolsk lnke %s -> %s
Autorisation mislykkedes
Bind-fejl (%s).
Kan ikke vre udfrlig og stille p samme tid.
Kan ikke tidsstemple og lade vre at berre eksisterende filer p samme tid.
Kan ikke sikkerhedskopiere %s som %s: %s
Kan ikke konvertere lnker i %s: %s
Kan ikke opstte PASV-overfrsel.
Kan ikke bne infokagefil %s: %s
Kan ikke tolke PASV-tilbagemelding.
Kan ikke skrive til '%s' (%s).
Kontakter %s:%hu... Kontakt med %s:%hu ngtet.
Fortstter i baggrunden.
Forbindelsen lukket.
Konverterer %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc.
Dette program distribueres i hb om at det bliver fundet nyttigt,
men UDEN NOGEN GARANTIER; ikke engang for SALGBARHED eller
EGNETHED TIL NOGEN SPECIEL OPGAVE.
Se 'GNU General Public License' for detaljer.
Fandt ikke proxy-server.
Laver symbolsk lnke %s -> %s
Dataoverfrsel afbrudt.
Kataloger:
-nd --no-directories lav ikke kataloger.
-x, --force-directories lav kataloger.
-nH, --no-host-directories lav ikke ovenstende kataloger.
-P, --directory-prefix=PRFIKS skriv filer til PRFIKS/...
--cut-dirs=ANTAL ignorr ANTAL komponenter af serverens
katalognavn.
Katalog Hente-kvote (%s byte) overskredet!
Hentning:
--bind-address=ADRESSE bind til ADRESSE (vrtsnavn eller IP) p lokal vrt.
-t, --tries=ANTAL maksimalt antal forsg (0 for uendelig).
-O --output-document=FIL skriv dokumenter til FIL.
-nc, --no-clobber berr ikke eksisterende filer, eller brug .#-endelser.
-c, --continue fortst hentning af en eksisterende fil.
--dot-style=TYPE vlg format for nedlastings-status.
-N, --timestamping hent ikke filer igen som er ldre end eksisterende.
-S, --server-response vis svar fra serveren.
--spider hent ikke filer.
-T, --timeout=SEKUNDER st ventetid ved lsning til SEKUNDER.
-w, --wait=SEKUNDER st ventetid mellem filer til SEKUNDER.
--waitretry=SEKUNDER wait 1...SEKUNDER mellem forsg p gentagelse af en hentning.
-Y, --proxy=on/off sl brug af proxy til eller fra.
-Q, --quota=ANTAL st hente-kvote til ANTAL.
FEJL: Omdirigering (%d) uden nyt sted.
Filafslutning fundet ved lsning af toptekster.
Fejl ved lukning af '%s': %s
fejl ved Set-Cookie, felt '%s' Fejl i velkomsthilsen fra server.
Fejl i svar fra server, lukker kontrolforbindelsen.
Fejl ved skrivning til '%s' %s
FTP-flag:
-nr, --dont-remove-listing fjern ikke `.listing' filer.
-g, --glob=on/off tolk (ikke) brug af jokertegn i filnavn.
--passive-ftp brug passiv overfrselsmetode.
--retr-symlinks hent filer (ikke kataloger) der er lnket til, ved rekursiv brug.
Kunne ikke f certifikatngle fra %s
Kunne ikke indlse certifikater fra %s
Kunne ikke opstte et SSL-milj
Kan ikke slette den symbolske lnke '%s': %s
Fejl ved skrivning af HTTP-foresprgsel: %s.
Fil File '%s' eksisterer allerede, hentes ikke.
Filen '%s' hentes ikke, fordi den allerede eksisterer.
GNU Wget %s, en ikke-interaktiv informationsagent.
Giver op.
HTTP-flag:
--http-user=BRUGER st HTTP-bruger til BRUGER.
--http-passwd=PASSORD st HTTP-adgangskode til PASSORD.
-C, --cache=on/off tillad (ikke) brug af mellemlager p server.
-E, --html-extension gem alle tekst/html dokumenter med .html filkode.
--ignore-length ignorer 'Content-Length' felt i toptekst.
--header=TEKST st TEKST ind som en toptekst.
--proxy-user=BRUGER st proxy-bruger til BRUGER.
--proxy-passwd=PASSORD st proxy-adgangskode til PASSORD.
--referer=URL brug `Referer: URL' kommando i HTTP-foresprgsel.
-s, --save-headers skriv HTTP-toptekster til fil.
-U, --user-agent=AGENT identificer som AGENT i stedet for
'Wget/VERSION'.
--no-http-keep-alive deaktivr HTTP keep-alive (overlevende forbindelser).
--cookies=off brug ikke infokager.
--load-cookies=FILE indls infokager fra FIL fr session.
--save-cookies=FILE gem infokager i FIL efter session.
Vrt ikke fundet Indeks for /%s p %s:%d Ugyldig PORT.
Vrtsnavnet er ugyldigt Ugyldigt navn for symbolsk lnke, ignoreres.
Port-specifikationen er ugyldig Last-modified toptekst ugyldig -- tidsstempel ignoreret.
Last-modified toptekst mangler -- tidsstempling sls fra.
Lngde: Lngde: %s Link Henter robots.txt; ignorer eventuelle fejlmeldinger.
Sted: %s%s
Logget ind!
Udskrifter og indlsning:
-o, --output-file=FIL skriv beskeder til FIL.
-a, --append-output=FIL tilfj beskeder til slutningen af FIL.
-d, --debug skriv fejlfindingsinformation.
-q, --quiet stille (ingen udskrifter).
-v, --verbose vr udfrlig (standard).
-nv, --non-verbose mindre udfrlig, men ikke stille.
-i, --input-file=FIL ls URLer fra FIL.
-F, --force-html ls inddatafil som HTML.
-B, --base=URL foranstiller URL til relative lnker i -F -i fil.
--sslcertfile=FIL valgbart klient-certifikat.
--sslcertkey=NGLEFIL valgbar nglefil for dette certifikat.
Logger ind som %s ... Fejl ved indlogging.
Rapportr fejl og send forslag til .
Forkert udformet statuslinje Fandt ingen URLer i %s.
Ingen data modtaget Ingenting passer med mnstret '%s'.
Intet katalog ved navn '%s'.
Ingen fil ved navn '%s'.
Ingen fil eller katalog ved navn '%s'.
Behandler ikke '%s' da det er ekskluderet/ikke inkluderet.
Usikker Uddata vil blive skrevet til '%s'.
Proxy %s: Skal understtte HTTP.
Lsefejl (%s) i toptekster.
Rekursionsdybde %d overskred maksimal dybde %d.
Hvad er tilladt ved rekursion:
-A, --accept=LISTE liste med tilladte filtyper.
-R, --reject=LISTE liste med ikke-tilladte filtyper.
-D, --domains=LISTE liste med tilladte domner.
--exclude-domains=LISTE liste med ikke-tilladte domner.
--follow-ftp flg FTP-lnker fra HTML-dokumenter.
--follow-tags=LIST komma-separeret liste af fulgte HTML-mrker.
-G, --ignore-tags=LIST komma-separeret liste af ignorerede HTML-mrker.
-H, --span-hosts flg lnker til andre vrter.
-L, --relative flg kun relative lnker.
-I, --include-directories=LISTE liste med tilladte katalognavne.
-X, --exclude-directories=LISTE liste med ikke-tilladte katalognavne.
-nh, --no-host-lookup led ikke efter vrtsnavn via DNS.
-np, --no-parent flg ikke lnke til ovenliggende katalog.
Rekursiv nedlasting:
-r, --recursive tillad rekursiv nedlasting -- brug med omtanke!
-l, --level=ANTAL maksimalt antal rekursionsniveauer (0=uendelig).
--delete-after slet hentede filer.
-k, --convert-links konverter absolutte lnker til relative.
-K, --backup-converted fr fil X konverteres, sikkerhedskopir som X.orig.
-m, --mirror st passende flag for spejling af servere.
-p, --page-requisites hent alle billeder osv. der er ndvendige for at vise HTML siden.
Ignorerer '%s'.
Fjernfil er nyere end lokal fil '%s' - hentes.
Fil p server er nyere - hentes.
Fjernfil ikke nyere end lokal fil '%s' - hentes ikke.
Slettet '%s'.
Fjerner %s fordi den skal forkastes.
Fjerner %s.
Prver igen.
Genbruger forbindelse til %s:%hu.
Serverfejl, kan ikke bestemme systemtype.
Serverfil ikke nyere end lokal fil '%s' - hentes ikke.
Ignorerer katalog '%s'.
Starter WinHelp %s
Opstart:
-V, --version vis Wget's versionsnummer og afslut.
-h, --help udskriv denne hjlpetekst.
-b, --background kr i baggrunden efter opstart.
-e, --execute=KOMMANDO udfr en '.wgetrc'-kommando.
Symbolske lnker ikke understttet, ignorerer '%s'.
Syntaksfejl i Set-Cookie ved tegnet '%c'.
Syntaksfejl i Set-Cookie: streng afsluttet for tidligt.
Serveren tillader ikke indlogning.
Strrelserne er forskellige (lokal %ld) - hentes.
Strrelserne er forskellige (lokal %ld) - hentes.
Prv '%s --help' for flere flag.
Prver uden det angivne certifikat
Kan ikke slette '%s': %s
Kunne ikke etablere SSL-forbindelse.
Ukendt autorisations-protokol.
Ukendt fejl Ukendt type '%c', lukker kontrolforbindelsen.
Protokollen er ukendt/ikke understttet Ikke-understttet listningstype, prver Unix-listningsfortolker.
Brug: %s NETRC [VRTSNAVN]
Brug: %s [FLAG]... [URL]...
Bruger '%s' som midlertidig katalogliste.
Advarsel: jokertegn ikke understttet i HTTP.
Henter ikke kataloger, da dybde er %d (max %d).
Vil prve at kontakte %s:%hu.
Fejl ved skrivning, lukker kontrolforbindelsen.
Skrev HTML-formateret indeks til '%s' [%ld].
Skrev HTML-formateret indeks til '%s'.
kontakt!
O.k.
O.k. frdig. ignoreret ingenting at gre.
ukendt tid uspecificeret v ikke ovenstende kataloger.
-P, --directory-prefix=PRFIKS skriv filer til PRFIKS/...
--cut-dirs=ANTAL ignorr ANTAL komponenter af serverens
katalognavn.
Katalog Hente-kvote (%s byte) overs./share/locale/de/ 755 0 0 0 7445172714 7021 ./share/locale/de/LC_MESSAGES/ 755 0 0 0 7445172714 10606 ./share/locale/de/LC_MESSAGES/wget.mo 644 0 0 73462 7445172714 12232 : n 2
K @ > % & $ 0 D P ] ) x - & + C ! d * & $ . , $ [ $ 2 " 0 ? O + ( ; 8 \ # " , 3 ` % ~ , & # < \ m w ' - < " _ | " 1 N i $ P
, ) V q Y $ O * e! # ! ! ! % ! " 6 -" d" " " & # $ #
$ " +$ ! N$ p$ ) }$ , $ 2 $ % % ( ) ) 9 *) ' d) 4 ) 8 ) )
* * * * F* V* b* M- c- 8 u- - - - - . ". ! 7. 7 Y. . . . + . / 2 4 : 4 " 5 = #5 a5 ) p5
5 5 5 5 + 5 > 6 O6 i6 ~6 / o7 . 7 5 7 8 2 8 3 R8 8 " q9 ) 9 9 $ 9 9
: / ,: 6 \: : : : * : 3 ; * O; % z; ; ; ; ; ; ; < < < *< >< ! J< E l= = = > / &? Y V? E ? 5 ? 2 ,@ _@
k@ v@
@ @ ) @ / @ 3 @ (A ' IA , qA & A ' A " A B * #B . NB ' }B 7 B ) B C ! &C 0 HC ' yC C % C E C ( (D QD / nD ! D D % D F E HE fE - E E E E ( E 'F & GF ( nF ' F 3 F ! F ! G 7G
LG ZG tG ? G G G A
H M LH : H ' H & H 1 $I # VI % zI I # I I ! J ) %J OJ P gJ J T J ' +K SK sK HM * UM M % ~S 2 S $ S S : T & XT A T + T % T U 9 V ) V ) W = 1W 0 oW W < W 8 W L #X
pX ~X ] ] ] D ] > ^ > S^ = ^ ^ ^ ^ , ^ _ )_ Z 6_ b b b ]c xc c # c % c c 4 d P Id d $ d ( d > d ] 4e j ]m L sm 3 m M m Bn 3 Rn n n n + n M n N Eo o o o L p / q = Cq % q ? q @ q K (r ( ts ) s * s 8 s & +t Rt 3 et M t t u . %u : Tu Q u 6 u . v * Gv rv 3 ~v v v v v
v v w w N j t * U 4 O z , E e { } | $ M u F s 8 / G H ; h 7 & 1 x W = # L f r - Y D 9 q a ' 2 I b w B [ i K ! " c 6 + v @ J 5 g p n R Z _ % C l ( ? S : V X m 0 ` A d
3 > y
o \ Q ^ . k ) ~ P ] < T
The file is already fully retrieved; nothing to do.
%*s[ skipping %dK ]
CTRL+Break received, redirecting output to `%s'.
Execution continued in background.
You may stop Wget by pressing CTRL+ALT+DELETE.
Continued download failed on this file, which conflicts with `-c'.
Refusing to truncate existing file `%s'.
FINISHED --%s--
Downloaded: %s bytes in %d files
Mandatory arguments to long options are mandatory for short options too.
Originally written by Hrvoje Niksic .
REST failed, starting from scratch.
REST failed; will not truncate `%s'.
(%s bytes) (%s to go) (unauthoritative)
[%s to go] [following] %d redirections exceeded.
%s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld]
%s (%s) - `%s' saved [%ld/%ld])
%s (%s) - `%s' saved [%ld]
%s ERROR %d: %s.
%s received, redirecting output to `%%s'.
%s request sent, awaiting response... %s: %s, closing control connection.
%s: %s: Cannot convert `%s' to an IP address.
%s: %s: Invalid progress type `%s'.
%s: %s: Invalid specification `%s'.
%s: %s: Not enough memory.
%s: %s: Please specify always, on, off, or never.
%s: %s: Please specify on or off.
%s: %s: invalid command
%s: %s:%d: unknown token "%s"
%s: %s:%d: warning: "%s" token appears before any machine name
%s: BUG: unknown command `%s', value `%s'.
%s: Cannot read %s (%s).
%s: Couldn't find usable socket driver.
%s: Error in %s at line %d.
%s: Invalid specification `%s'
%s: Redirection cycle detected.
%s: Warning: Both system and user wgetrc point to `%s'.
%s: cannot stat %s: %s
%s: corrupt time-stamp.
%s: debug support not compiled in.
%s: illegal option -- %c
%s: illegal option -- `-n%c'
%s: missing URL
%s: option `%c%s' doesn't allow an argument
%s: option `%s' is ambiguous
%s: option `%s' requires an argument
%s: option `--%s' doesn't allow an argument
%s: option requires an argument -- %c
%s: unknown/unsupported file type.
%s: unrecognized option `%c%s'
%s: unrecognized option `--%s'
(no description) (try:%2d) ==> CWD not needed.
==> CWD not required.
Already have correct symlink %s -> %s
Authorization failed.
Bind error (%s).
Can't be verbose and quiet at the same time.
Can't timestamp and not clobber old files at the same time.
Cannot back up %s as %s: %s
Cannot convert links in %s: %s
Cannot initiate PASV transfer.
Cannot open cookies file `%s': %s
Cannot parse PASV response.
Cannot write to `%s' (%s).
Connecting to %s:%hu... Connecting to %s[%s]:%hu... Continuing in background.
Control connection closed.
Converted %d files in %.2f seconds.
Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc.
Could not find proxy host.
Could not seed OpenSSL PRNG; disabling SSL.
Creating symlink %s -> %s
Data transfer aborted.
Directories:
-nd --no-directories don't create directories.
-x, --force-directories force creation of directories.
-nH, --no-host-directories don't create host directories.
-P, --directory-prefix=PREFIX save files to PREFIX/...
--cut-dirs=NUMBER ignore NUMBER remote directory components.
Directory Download quota (%s bytes) EXCEEDED!
Download:
--bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host.
-t, --tries=NUMBER set number of retries to NUMBER (0 unlimits).
-O --output-document=FILE write documents to FILE.
-nc, --no-clobber don't clobber existing files or use .# suffixes.
-c, --continue resume getting a partially-downloaded file.
--progress=TYPE select progress gauge type.
-N, --timestamping don't re-retrieve files unless newer than local.
-S, --server-response print server response.
--spider don't download anything.
-T, --timeout=SECONDS set the read timeout to SECONDS.
-w, --wait=SECONDS wait SECONDS between retrievals.
--waitretry=SECONDS wait 1...SECONDS between retries of a retrieval.
--random-wait wait from 0...2*WAIT secs between retrievals.
-Y, --proxy=on/off turn proxy on or off.
-Q, --quota=NUMBER set retrieval quota to NUMBER.
--limit-rate=RATE limit download rate to RATE.
ERROR: Redirection (%d) without location.
End of file while parsing headers.
Error closing `%s': %s
Error in Set-Cookie, field `%s' Error in proxy URL %s: Must be HTTP.
Error in server greeting.
Error in server response, closing control connection.
Error parsing proxy URL %s: %s.
Error writing to `%s': %s
FTP options:
-nr, --dont-remove-listing don't remove `.listing' files.
-g, --glob=on/off turn file name globbing on or off.
--passive-ftp use the "passive" transfer mode.
--retr-symlinks when recursing, get linked-to files (not dirs).
Failed to get certificate key from %s
Failed to load certificates from %s
Failed to set up an SSL context
Failed to unlink symlink `%s': %s
Failed writing HTTP request: %s.
File File `%s' already there, not retrieving.
File `%s' already there, will not retrieve.
GNU Wget %s, a non-interactive network retriever.
Giving up.
HTTP options:
--http-user=USER set http user to USER.
--http-passwd=PASS set http password to PASS.
-C, --cache=on/off (dis)allow server-cached data (normally allowed).
-E, --html-extension save all text/html documents with .html extension.
--ignore-length ignore `Content-Length' header field.
--header=STRING insert STRING among the headers.
--proxy-user=USER set USER as proxy username.
--proxy-passwd=PASS set PASS as proxy password.
--referer=URL include `Referer: URL' header in HTTP request.
-s, --save-headers save the HTTP headers to file.
-U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION.
--no-http-keep-alive disable HTTP keep-alive (persistent connections).
--cookies=off don't use cookies.
--load-cookies=FILE load cookies from FILE before session.
--save-cookies=FILE save cookies to FILE after session.
Host not found Index of /%s on %s:%d Invalid PORT.
Invalid dot style specification `%s'; leaving unchanged.
Invalid name of the symlink, skipping.
Last-modified header invalid -- time-stamp ignored.
Last-modified header missing -- time-stamps turned off.
Length: Length: %s Link Loading robots.txt; please ignore errors.
Location: %s%s
Logged in!
Logging and input file:
-o, --output-file=FILE log messages to FILE.
-a, --append-output=FILE append messages to FILE.
-d, --debug print debug output.
-q, --quiet quiet (no output).
-v, --verbose be verbose (this is the default).
-nv, --non-verbose turn off verboseness, without being quiet.
-i, --input-file=FILE download URLs found in FILE.
-F, --force-html treat input file as HTML.
-B, --base=URL prepends URL to relative links in -F -i file.
--sslcertfile=FILE optional client certificate.
--sslcertkey=KEYFILE optional keyfile for this certificate.
--egd-file=FILE file name of the EGD socket.
Logging in as %s ... Login incorrect.
Mail bug reports and suggestions to .
Malformed status line No URLs found in %s.
No data received No matches on pattern `%s'.
No such directory `%s'.
No such file `%s'.
No such file or directory `%s'.
Not descending to `%s' as it is excluded/not-included.
Not sure Output will be written to `%s'.
Read error (%s) in headers.
Recursion depth %d exceeded max. depth %d.
Recursive accept/reject:
-A, --accept=LIST comma-separated list of accepted extensions.
-R, --reject=LIST comma-separated list of rejected extensions.
-D, --domains=LIST comma-separated list of accepted domains.
--exclude-domains=LIST comma-separated list of rejected domains.
--follow-ftp follow FTP links from HTML documents.
--follow-tags=LIST comma-separated list of followed HTML tags.
-G, --ignore-tags=LIST comma-separated list of ignored HTML tags.
-H, --span-hosts go to foreign hosts when recursive.
-L, --relative follow relative links only.
-I, --include-directories=LIST list of allowed directories.
-X, --exclude-directories=LIST list of excluded directories.
-np, --no-parent don't ascend to the parent directory.
Recursive retrieval:
-r, --recursive recursive web-suck -- use with care!
-l, --level=NUMBER maximum recursion depth (inf or 0 for infinite).
--delete-after delete files locally after downloading them.
-k, --convert-links convert non-relative links to relative.
-K, --backup-converted before converting file X, back up as X.orig.
-m, --mirror shortcut option equivalent to -r -N -l inf -nr.
-p, --page-requisites get all images, etc. needed to display HTML page.
Rejecting `%s'.
Remote file is newer than local file `%s' -- retrieving.
Remote file is newer, retrieving.
Remote file no newer than local file `%s' -- not retrieving.
Removed `%s'.
Removing %s since it should be rejected.
Removing %s.
Resolving %s... Retrying.
Reusing connection to %s:%hu.
Server error, can't determine system type.
Server file no newer than local file `%s' -- not retrieving.
Skipping directory `%s'.
Starting WinHelp %s
Startup:
-V, --version display the version of Wget and exit.
-h, --help print this help.
-b, --background go to background after startup.
-e, --execute=COMMAND execute a `.wgetrc'-style command.
Symlinks not supported, skipping symlink `%s'.
Syntax error in Set-Cookie at character `%c'.
Syntax error in Set-Cookie: premature end of string.
The server refuses login.
The sizes do not match (local %ld) -- retrieving.
The sizes do not match (local %ld) -- retrieving.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
Try `%s --help' for more options.
Trying without the specified certificate
Unable to delete `%s': %s
Unable to establish SSL connection.
Unknown authentication scheme.
Unknown error Unknown type `%c', closing control connection.
Unsupported listing type, trying Unix listing parser.
Usage: %s NETRC [HOSTNAME]
Usage: %s [OPTION]... [URL]...
Using `%s' as listing tmp file.
Warning: wildcards not supported in HTTP.
Will not retrieve dirs since depth is %d (max %d).
Write failed, closing control connection.
Wrote HTML-ized index to `%s' [%ld].
Wrote HTML-ized index to `%s'.
connected.
couldn't connect to %s:%hu: %s
done.
done. done. failed: %s.
ignored nothing to do.
time unknown unspecified Project-Id-Version: wget 1.8
POT-Creation-Date: 2001-12-08 23:28+0100
PO-Revision-Date: 2001-12-10 21:10+0200
Last-Translator: Jochen Hein
Language-Team: German
MIME-Version: 1.0
Content-Type: text/plain; charset=iso-8859-1
Content-Transfer-Encoding: 8-bit
Download der Datei schon vollstndig; kein Download notwendig.
%*s[ berspringe %dK ]
CTRL+Break (= Strg+Untbr) empfangen, Ausgabe wird nach %s umgeleitet.
Ausfhrung wird im Hintergrund fortgefhrt.
Wget kann durch das Drcken von CTRL+ALT+DELETE (= Strg+Alt+Entf)
gestoppt werden.
Die Fortfhrung des Downloads ist fehlgeschlagen; dies ist ein
Widerspruch zur Option -c.
Die vorhandene Datei %s wird nicht abgeschnitten.
BEENDET --%s--
Geholt: %s Bytes in %d Dateien
Erforderliche Argumente zu langen Optionen sind auch bei kurzen Optionen erforderlich.
Ursprnglich geschrieben von Hrvoje Niksic .
REST schlug fehl; es wird wieder von vorn begonnen.
REST schlug fehl; %s wird nicht abgeschnitten.
(%s Bytes) (noch %s) (unmageblich)
[noch %s] [folge] %d: Die Anzahl der Verweise ist zu gro.
%s (%s) - Verbindung bei Byte %ld geschlossen. %s (%s) - Verbindung bei Byte %ld/%ld geschlossen. %s (%s) - Daten-Verbindung: %s; %s (%s) - Lesefehler bei Byte %ld (%s). %s (%s) - Lesefehler bei Byte %ld/%ld (%s). %s (%s) - %s gespeichert [%ld/%ld]
%s (%s) - %s gespeichert [%ld/%ld])
%s (%s) - %s gespeichert [%ld]
%s FEHLER %d: %s.
%s erhalten, Ausgabe nach %%s umleiten.
%s Anforderung gesendet, warte auf Antwort... %s: %s; Kontroll-Verbindung schlieen.
%s: %s: %s ist nicht in eine IP-Adresse umwandelbar.
%s: %s: Ungltiger Fortschrittstyp %s.
%s: %s: Ungltige Angabe %s
%s: %s: Nicht gengend Speicher.
%s: %s: Bitte on, off oder never angeben.
%s: %s: Bitte on oder off angeben.
%s: %s: ungltiger Befehl
%s: %s:%d: unbekannter Wortteil %s
%s: %s:%d: Warnung: %s-Wortteil erscheint vor einem Maschinennamen
%s: Unbekannter Befehl %s, Wert %s.
%s: %s nicht lesbar (%s).
%s: Kein benutzbar "socket driver" auffindbar.
%s: Fehler in %s bei Zeile %d.
%s: Ungltige Angabe %s
%s: Zyklischer Verweis festgestellt.
%s: Warnung: wgetrc des Systems und des Benutzers zeigen nach %s.
%s: kann nicht finden %s: %s
%s: beschdigter Zeitstempel.
%s: Debug-Untersttzung nicht einkompiliert.
%s: ungltige Option -- %c
%s: ungltige Option -- -n%c
%s: URL fehlt
%s: Option %c%s erlaubt kein Argument
%s: Option %s ist zweideutig
%s: Option %s bentigt ein Argument
%s: Option --%s erlaubt kein Argument
%s: Option verlangt ein Argument -- %c
%s: unbekannter bzw. nicht untersttzter Dateityp.
%s: nicht erkannte Option %c%s
%s: nicht erkannte Option --%s
(keine Beschreibung) (Versuch:%2d) ==> CWD nicht notwendig.
==> CWD nicht erforderlich.
Der richtige symbolische Verweis %s -> %s ist schon vorhanden.
Authorisierung fehlgeschlagen.
Verbindungsfehler (%s).
Ausfhrliche und keine Meldungen ist gleichzeitig unmglich.
Zeitstempel und berschreibung alter Dateien ist gleichzeitig unmglich.
Anlegen eines Backups von %s als %s nicht mglich: %s
Verweise nicht umwandelbar in %s: %s
Kann PASV-bertragung nicht beginnen.
Cookie-Datei %s kann nicht geffnet werden: %s
Kann PASV-Antwort nicht auswerten.
Kann nicht nach %s schreiben (%s).
Verbindungsaufbau zu %s:%hu... Verbindungsaufbau zu %s[%s]:%hu... Im Hintergrund geht's weiter.
Kontroll-Verbindung geschlossen.
%d Dateien in %.2f Sekunden konvertiert.
Umwandlung von %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc.
Proxy-Host nicht auffindbar.
SSL deaktiviert, weil der Zufallszahlengenerator nicht initialisiert werden konnte.
Symbolischen Verweis %s -> %s anlegen.
Daten-bertragung abgebrochen.
Verzeichnisse:
-nd --no-directories keine Verzeichnisse anlegen
-x, --force-directories Anlegen von Verzeichnissen erwingen
-nH, --no-host-directories keine Host-Verzeichnisse anlegen
-P, --directory-prefix=PREFIX Dateien unter dem Verzeichnis PREFIX/...
speichern
--cut-dirs=ZAHL ZAHL der Verzeichnisebenen der Gegenseite
berspringen
Verzeichnis Download-Kontingent (%s Bytes) ERSCHPFT!
Download:
--bind-address=ADRESSE fr den lokalen Rechner ADRESSE (Hostname oder
IP) vorgeben
-t, --tries=ZAHL Anzahl der Wiederholversuche auf ZAHL setzen
(0 steht fr unbegrenzt)
-O --output-document=DATEI Dokumente in DATEI schreiben
-nc, --no-clobber bestehende Dateien nicht berschreiben oder
.# Suffix verwenden
-c, --continue Fortfhrung des Downloads einer bereits zum
Teil geholten Datei
--progress=STYLE Anzeige fr den Download auf STYLE setzen
-N, --timestamping Nur Dateien holen, die neuer als die lokalen
Dateien sind
-S, --server-response Antwort des Servers anzeigen
--spider kein Download (don't download anything)
-T, --timeout=SEKUNDEN den Lese-Timeout auf SEKUNDEN setzen
-w, --wait=SEKUNDEN SEKUNDEN zwischen den Downloads warten
--waitretry=SEKUNDEN 1...SEKUNDEN zwischen den erneuten Versuchen
warten
--random-wait Zwischen 0 und 2*WAIT Sekunden zwischen
Versuchen warten
-Y, --proxy=on/off Proxy ein (on) oder aus (off) stellen
-Q, --quota=ZAHL Kontingent fr den Download auf ZAHL setzen
--limit-rate=RATE Datenrate beim Download auf RATE begrenzen
FEHLER: Umleitung (%d) ohne Ziel(?).
Dateiende beim Auswerten des Vorspanns (headers).
Fehler beim Schlieen von %s: %s.
Fehler bei Set-Cookie, Feld %s Fehler in der Proxy-URL %s: Es muss eine HTTP-URL sein.
Fehler bei der Begrung des Servers.
Fehler in der Antwort des Servers; schliee Kontroll-Verbindung.
Fehler beim Parsen der Proxy-URL %s: %s.
Fehler beim Schreiben nach %s: %s.
FTP-Optionen:
-nr, --dont-remove-listing .listing-Dateien nicht entfernen
-g, --glob=on/off Dateinamen-Globbing ein- (on) oder ausstellen
(off)
--passive-ftp den "passiven" bertragungsmodus verwenden
--retr-symlinks falls auftretend, verlinkte Dateien holen (keine
Verzeichnisse)
Fehlversuch den Zertifikat-Schlssel von %s zu erhalten.
Fehler beim Laden der Zertifikate von %s
Fehler beim Herstellen des SSL-Kontextes
Entfernen des symbolischen Verweises %s fehlgeschlagen: %s
Fehler beim Schreiben der HTTP-Anforderung: %s.
Datei Die Datei %s ist schon vorhanden, kein erneuter Download.
Datei %s ist schon vorhanden, kein erneuter Download.
GNU Wget %s, ein nicht-interaktives Netz-Werkzeug zum Download von Dateien.
Aufgegeben.
HTTP-Optionen:
--http-user=BENUTZER http-Benutzer auf BENUTZER setzen
--http-passwd=PASS http-Passwort auf PASS setzen
-C, --cache=on/off server-gepufferte Daten erlauben/verbieten
(server-cached data) (normalerweise erlaubt)
-E, --html-extension alle text/html-Dokumente mit dem Suffix .html
speichern
--ignore-length das Content-Length-Kopffeld ignorieren
--header=ZEICHENKETTE ZEICHENKETTE zwischen die Kopfzeilen einfgen
--proxy-user=BENUTZER BENUTZER als Proxy-Benutzername setzen
--proxy-passwd=PASS PASS als Proxy-Passwort setzen
--referer=URL die Kopfzeile `Referer: URL' der HTTP-Anforderung
hinzufgen
-s, --save-headers den HTTP-Vorspann (header lines) in Datei sichern
-U, --user-agent=AGENT als AGENT anstelle of Wget/VERSION identifizieren
--no-http-keep-alive HTTP keep-alive (ununterbrochene Verbindungen)
deaktivieren
--cookies=off Cookies nicht verwenden
--load-cookies=DATEI Cookies vor der Sitzung aus der DATEI laden
--save-cookies=DATEI Cookies nach der Sitzung in der DATEI speichern
Host nicht gefunden Index von /%s auf %s:%d Ungltiger PORT.
Ungltiger Stil fr den Fortschrittsindikator %s; keine nderung.
Ungltiger Name fr einen symbolischen Verweis; bersprungen.
Last-modified-Kopfzeile ungltig -- Zeitstempel bergangen.
Last-modified-Kopfzeile fehlt -- Zeitstempel abgeschaltet.
Lnge: Lnge: %s Verweis Lade robots.txt; bitte Fehler ignorieren.
Platz: %s%s
Angemeldet!
Log-Datei schreiben und Eingabe-Datei:
-o, --output-file=DATEI Protokoll-Meldungen in DATEI schreiben
-a, --append-output=DATEI Meldungen der DATEI anhngen
-d, --debug Debug-Ausgabe anzeigen
-q, --quiet keine Ausgabe von Meldungen
-v, --verbose ausfhrliche Meldungen (Vorgabe)
-nv, --non-verbose Meldungen weniger ausfhrlich, aber nicht --quiet
-i, --input-file=DATEI in DATEI gelistete URLs holen
-F, --force-html Eingabe-Datei als HTML behandeln
-B, --base=URL URL relativen Links in -F -i DATEI voranstellen
--sslcertfile=DATEI optionales Client-Zertifikat.
--sslcertkey=SCHLSSEL_DATEI
optionale SCHLSSEL_DATEI fr dieses Zertifikat.
--egd-file=FILE Dateiname des EGD Sockets.
Anmelden als %s ... Fehler bei der Anmeldung.
Fehlerberichte und Verbesserungsvorschlge bitte an
schicken.
Fr die deutsche bersetzung ist die Mailingliste zustndig.
Nicht korrekte Statuszeile Keine URLs in %s gefunden.
Keine Daten empfangen Keine Treffer bei dem Muster %s.
Das Verzeichnis %s gibt es nicht.
Die Datei %s gibt es nicht.
Die Datei oder das Verzeichnis %s gibt es nicht.
Nicht zu %s hinabsteigen, da es ausgeschlossen bzw. nicht eingeschlossen ist.
Nicht sicher Ausgabe wird nach %s geschrieben.
Lesefehler (%s) beim Vorspann (header).
Die Rekursionstiefe %d bersteigt die max. erlaubte Tiefe %d.
Rekursiv erlauben/zurckweisen:
-A, --accept=LISTE komma-unterteilte Liste der erlaubten
Dateiendungen
-R, --reject=LISTE komma-unterteilte Liste der
zurckzuweisenden Erweiterungen
-D, --domains=LISTE komma-unterteilte Liste der erlaubten
Domains
--exclude-domains=LISTE komma-unterteilte Liste der
zurckzuweisenden Domains
--follow-ftp FTP-Verweisen von HTML-Dokumenten aus
folgen
--follow-tags=LISTE komma-unterteilte Liste der zu folgenden
HTML-Tags
-G, --ignore-tags=LISTE komma-unterteilte Liste der zu
missachtenden HTML-Tags
-H, --span-hosts wenn --recursive, auch zu fremden Hosts
gehen
-L, --relative nur relativen Verweisen folgen
-I, --include-directories=LISTE Liste der erlaubten Verzeichnisse
-X, --exclude-directories=LISTE Liste der auszuschlieenden Verzeichnisse
-np, --no-parent nicht in das bergeordnete Verzeichnis
wechseln
Rekursives Holen:
-r, --recursive rekursiver Download -- mit Umsicht verwenden!
-l, --level=Zahl maximale Rekursionstiefe (inf oder 0 steht
fr ohne Begrenzung)
--delete-after geholte Dateien nach dem Download lschen
-k, --convert-links nicht-relative Links in relative umwandeln
-K, --backup-converted vor dem Umwandeln der Datei X, ein Backup als
X.orig anlagen.
-m, --mirror Kurzform, die -r -N -l inf -nr entspricht.
-p, --page-requisites alle Bilder usw. holen, die fr die Anzeige
der HTML-Seite notwendig sind
%s zurckgewiesen.
Datei auf dem Server neuer als die lokale Datei %s, -- erneuter Download.
Datei der Gegenseite ist neuer, erneuter Download.
Datei auf dem Server nicht neuer als die lokale Datei %s -- kein Download.
%s gelscht.
Entferne %s, da dies zurckgewiesen werden soll.
Entferne %s.
Auflsen des Hostnamen %s.... Erneuter Versuch.
Weiterverwendung der Verbindung zu %s:%hu.
Fehler beim Server; es ist nicht mglich, die Art des Systems festzustellen.
Datei auf dem Server nicht neuer als die lokale Datei %s -- kein Download.
Verzeichnis %s bersprungen.
WinHelp %s wird gestartet
Beim Start:
-V, --version Programmversion anzeigen
-h, --help diese Hilfe anzeigen
-b, --background nach dem Starten in den Hintergrund gehen
-e, --execute=BEFEHL einen .wgetrc-artigen Befehl ausfhren
Symbolischer Verweis nicht mglich; symbolischer Verweis %s bersprungen.
Syntaxfehler bei Set-Cookie beim Zeichen %c.
Syntaxfehler bei Set-Cookie, Zeichenkette vorzeitig zu Ende.
Der Server verweigert die Anmeldung.
Gren stimmen nicht berein (lokal %ld) -- erneuter Download.
Gren stimmen nicht berein (lokal %ld) -- erneuter Download.
Dieses Programm wird in der Hoffnung verteilt, dass es ntzlich ist.
Es gibt KEINERLEI Garantie, nicht einmal fr die TAUGLICHKEIT oder die
VERWENDBARKEIT ZU EINEM ANGEGEBENEN ZWECK. In den Quellen befindet sich die
Lizenz- und Kopierbedingung; die Einzelheiten sind in der Datei COPYING
(GNU General Public License) beschrieben.
%s --help gibt weitere Informationen.
Versuch ohne die angegebenen Zertifikate
Es ist nicht mglich, %s zu lschen: %s
Es ist nicht mglich, eine SSL-Verbindung herzustellen.
Unbekanntes Authentifizierungsschema.
Unbekannter Fehler Unbekannte Art %c, schliee Kontroll-Verbindung.
Nicht untersttzte Art der Auflistung; Versuch Unix-Auflistung zu verwenden.
Syntax: %s NETRC [HOSTNAME]
Syntax: %s [OPTION]... [URL]...
%s als temporre Auflistungsdatei benutzen.
Warnung: Joker-Zeichen werden bei HTTP nicht untersttzt.
Verzeichnisse nicht erneut holen; da die Tiefe bereits %d ist (max. erlaubt %d).
Schreiben schlug fehl; Kontroll-Verbindung schlieen.
HTML-artigen Index nach %s [%ld] schreiben.
HTML-artiger Index nach %s geschrieben.
verbunden.
Konnte keine Verbindung zu %s:%hu herstellen: %s
fertig.
fertig. fertig. fehlgeschlagen: %s.
bergangen kein Download notwendig.
Zeit unbekannt nicht spezifiziert ntfernen des symbolischen Verweises %s fehlgeschlagen: %s
Fehler beim Schreiben der HTTP-Anforderung: %s.
Datei Die Datei %s ist schon vorhanden, kein erneuter Download.
Datei %s ist schon v./share/locale/el/ 755 0 0 0 7445172715 7032 ./share/locale/el/LC_MESSAGES/ 755 0 0 0 7445172715 10617 ./share/locale/el/LC_MESSAGES/wget.mo 644 0 0 34766 7445172715 12247 | 2 j
K
%
' ; G ) T - ~ & + ! @ b * & $ $ - " I l ? + / ( I r 8 0 5 O A p # & @ ^ , o % , &
# 4 X x ' - 0 < ^ - L g Y > $ K * p # 6 " 4 ) A , k 2 ' F 4 a 8
* + 7 M 8 _ ! ! 7 C { + " ? ) N
x / " /
O / ] * 3 2 f * %
$ 8 D D ! ! 6 ;" b r" 3 " # #
'# 5# E# , R# 0 # ! # - # 2 $ ' 3$ ( [$ # $ $ , $ / $ # % <% " ]% " % % $ % X % $ ;& 9 `& & - & ! & ' Z (' J ' J ' ) ( V C( ' ( " ( " ( H ) Q) " p) ) + ) ! ) " ) + * * H* - s* # * # * * * + $+ . =+ l+ + ; + i + * H, 3 s, 1 , % , , ! - 7- Q- m- $ - % - ( - x - o/ M |/ ( / 5 / , )0 A V0 1 0 0 - 0 0 1 D 61 {1 1 1 1 1 5 1 $2 I C2 K 2 2 2 2 F 2 ?3 P3 c3 3 A 3 3 3 4 ) &4 $ P4 u4 & 4 J 4 5 5 95 & Z5 B 5 5 6 5 6 . #6 R6 d6 w6 6 E 6 & 6 ; 7 T7 u7 + 7 $ 7 $ 7 7 < 8 G X8 B 8 # 8 < 9 2 D9 , w9 9 9 9
9 9 9 9 R L w T d , = % e 8 p ! Q A f b y + z i 6 U v 9 0 n m ? a ` < N \ l S J j O -
c ] " V @ { / g ( W u
' } 5 o H ^ ~ 7 Z 4 $ I q F 2 M * B D Y h x : | [ _ ; K > E & . X 3 r ) t P # s k C 1 G
[ skipping %dK ]
CTRL+Break received, redirecting output to `%s'.
Execution continued in background.
You may stop Wget by pressing CTRL+ALT+DELETE.
FINISHED --%s--
Downloaded: %s bytes in %d files
Mandatory arguments to long options are mandatory for short options too.
REST failed, starting from scratch.
(%s bytes) (%s to go) (unauthoritative)
[%s to go] [following] %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld]
%s (%s) - `%s' saved [%ld/%ld])
%s (%s) - `%s' saved [%ld]
%s ERROR %d: %s.
%s received, redirecting output to `%%s'.
%s request sent, awaiting response... %s: %s, closing control connection.
%s: %s: Invalid specification `%s'.
%s: %s: Not enough memory.
%s: %s: Please specify on or off.
%s: %s: invalid command
%s: %s:%d: unknown token "%s"
%s: %s:%d: warning: "%s" token appears before any machine name
%s: BUG: unknown command `%s', value `%s'.
%s: Cannot determine user-id.
%s: Cannot read %s (%s).
%s: Couldn't find usable socket driver.
%s: Error in %s at line %d.
%s: Invalid specification `%s'
%s: Warning: Both system and user wgetrc point to `%s'.
%s: Warning: cannot determine local IP address.
%s: Warning: cannot reverse-lookup local IP address.
%s: Warning: gethostname failed
%s: Warning: reverse-lookup of local address did not yield FQDN!
%s: Warning: uname failed: %s
%s: cannot stat %s: %s
%s: corrupt time-stamp.
%s: debug support not compiled in.
%s: illegal option -- %c
%s: illegal option -- `-n%c'
%s: missing URL
%s: option `%c%s' doesn't allow an argument
%s: option `%s' is ambiguous
%s: option `%s' requires an argument
%s: option `--%s' doesn't allow an argument
%s: option requires an argument -- %c
%s: unknown/unsupported file type.
%s: unrecognized option `%c%s'
%s: unrecognized option `--%s'
(no description) (try:%2d) ==> CWD not needed.
==> CWD not required.
Already have correct symlink %s -> %s
Authorization failed.
Bind error (%s).
Can't be verbose and quiet at the same time.
Can't timestamp and not clobber old files at the same time.
Cannot convert links in %s: %s
Cannot initiate PASV transfer.
Cannot parse PASV response.
Cannot write to `%s' (%s).
Connecting to %s:%hu... Connection to %s:%hu refused.
Continuing in background.
Control connection closed.
Converting %s... Could not find proxy host.
Creating symlink %s -> %s
Data transfer aborted.
Directories:
-nd --no-directories don't create directories.
-x, --force-directories force creation of directories.
-nH, --no-host-directories don't create host directories.
-P, --directory-prefix=PREFIX save files to PREFIX/...
--cut-dirs=NUMBER ignore NUMBER remote directory components.
Directory Download quota (%s bytes) EXCEEDED!
ERROR: Redirection (%d) without location.
End of file while parsing headers.
Error in server greeting.
Error in server response, closing control connection.
Failed to unlink symlink `%s': %s
File File `%s' already there, not retrieving.
File `%s' already there, will not retrieve.
GNU Wget %s, a non-interactive network retriever.
Giving up.
Host not found Index of /%s on %s:%d Invalid PORT.
Invalid host name Invalid name of the symlink, skipping.
Invalid port specification Last-modified header invalid -- time-stamp ignored.
Last-modified header missing -- time-stamps turned off.
Length: Length: %s Link Loading robots.txt; please ignore errors.
Location: %s%s
Logged in!
Logging in as %s ... Login incorrect.
Mail bug reports and suggestions to .
Malformed status line No URLs found in %s.
No data received No matches on pattern `%s'.
No such directory `%s'.
No such file `%s'.
No such file or directory `%s'.
Not descending to `%s' as it is excluded/not-included.
Not sure Output will be written to `%s'.
Proxy %s: Must be HTTP.
Read error (%s) in headers.
Recursion depth %d exceeded max. depth %d.
Rejecting `%s'.
Remote file is newer, retrieving.
Removed `%s'.
Removing %s since it should be rejected.
Removing %s.
Retrying.
Skipping directory `%s'.
Starting WinHelp %s
Symlinks not supported, skipping symlink `%s'.
The server refuses login.
Try `%s --help' for more options.
Unknown authentication scheme.
Unknown error Unknown type `%c', closing control connection.
Unknown/unsupported protocol Usage: %s NETRC [HOSTNAME]
Usage: %s [OPTION]... [URL]...
Using `%s' as listing tmp file.
Warning: wildcards not supported in HTTP.
Will not retrieve dirs since depth is %d (max %d).
Will try connecting to %s:%hu.
Write failed, closing control connection.
Wrote HTML-ized index to `%s' [%ld].
Wrote HTML-ized index to `%s'.
connected!
done.
done. done. ignored time unknown unspecified Project-Id-Version: GNU Wget 1.7-dev
POT-Creation-Date: 2001-02-23 13:23-0800
PO-Revision-Date: 1999-02-09 02:00+0000
Last-Translator: Simos KSenitellis
Language-Team: Greek
MIME-Version: 1.0
Content-Type: text/plain; charset=ISO-8859-7
Content-Transfer-Encoding: 8-bit
[ %dK ]
CTRL+Break , `%s'.
.
Wget CTRL+ALT+DELETE.
--%s--
: %s bytes %d
.
REST, .
(%s bytes) (%s ) ()
[%s ] [] %s (%s) - byte %ld. %s (%s) - byte %ld/%ld. %s (%s) - : %s; %s (%s) - byte %ld (%s). %s (%s) - byte %ld/%ld (%s). %s (%s) - `%s' [%ld/%ld]
%s (%s) - `%s' [%ld/%ld])
%s (%s) - `%s' [%ld]
%s %d: %s.
%s , `%%s'.
%s , ... %s: %s, .
%s: %s: `%s'.
%s: %s: .
%s: %s: on off.
%s: %s:
%s: %s:%d: "%s"
%s: %s:%d: : "%s"
%s: `%s', `%s'.
%s: .
%s: %s (%s).
%s: .
%s: %s %d.
%s: `%s'.
%s: : wgetrc `%s'.
%s: : IP.
%s: : IP.
%s: : gethostname
%s: : FDQN!
%s: : uname : %s
%s: %s: %s
%s: .
%s: .
%s: -- %c
%s: -- `-n%c'
%s: URL
%s: `%c%s'
%s: `%s'
%s: `%s'
%s: `--%s'
%s: -- %c
%s: / .
%s: `%c%s'
%s: `--%s'
( ) (:%2d) ==> CWD .
==> CWD .
%s -> %s
.
(%s).
.
.
%s: %s
PASV.
PASV.
`%s' (%s).
%s:%hu... %s:%hu .
.
.
%s... proxy.
%s -> %s
.
:
-nd --no-directories .
-x, --force-directories .
-nH, --no-host-directories host directories.
-P, --directory-prefix= /...
--cut-dirs=
(%s bytes) !
: (%d) .
.
.
, .
`%s': %s
`%s' , .
`%s' , .
GNU Wget %s, - .
.
/%s %s:%d PORT.
, .
(port) Last-modified -- .
Last-modified -- .
: : %s robots.txt; .
: %s%s
!
%s ... .
.
URL %s.
`%s'.
`%s'.
`%s'.
`%s'.
`%s' /-
`%s'.
Proxy %s: HTTP.
(%s) .
%d %d.
`%s'.
, .
`%s'.
%s .
%s.
.
`%s'.
WinHelp %s
, `%s'.
.
`%s --help' .
.
`%c', .
/ : %s NETRC [ ]
: %s []... [URL]...
`%s' .
: (wildcards) HTTP.
%d ( %d).
%s:%hu.
, .
HTML `%s' [%ld].
HTML `%s'.
!
.
. . %s:%d Inv./share/locale/es/ 755 0 0 0 7445172716 7042 ./share/locale/es/LC_MESSAGES/ 755 0 0 0 7445172716 10627 ./share/locale/es/LC_MESSAGES/wget.mo 644 0 0 72250 7445172717 12246 : n 2
K @ > % & $ 0 D P ] ) x - & + C ! d * & $ . , $ [ $ 2 " 0 ? O + ( ; 8 \ # " , 3 ` % ~ , & # < \ m w ' - < " _ | " 1 N i $ P
, ) V q Y $ O * e! # ! ! ! % ! " 6 -" d" " " & # $ #
$ " +$ ! N$ p$ ) }$ , $ 2 $ % % ( ) ) 9 *) ' d) 4 ) 8 ) )
* * * * F* V* b* M- c- 8 u- - - - - . ". ! 7. 7 Y. . . . + . / 2 4 : 4 " 5 = #5 a5 ) p5
5 5 5 5 + 5 > 6 O6 i6 ~6 / o7 . 7 5 7 8 2 8 3 R8 8 " q9 ) 9 9 $ 9 9
: / ,: 6 \: : : : * : 3 ; * O; % z; ; ; ; ; ; ; < < < *< >< K J< J = = = y > 5 > j 1? B ? = ? 3 @ Q@ ]@ o@ @ @ # @ + @ / @ ! A / BA 3 rA # A $ A A B - !B , OB ) |B 7 B ) B & C # /C 9 SC ) C C $ C P C / FD vD D D D ! D # E U @E , E E 8 E F 4F QF 0 cF F ) F 0 F * G . 9G hG G G
G G G 3 G /H ! GH D iH P H : H 1 :I ) lI 0 I ' I " I J ,J JJ iJ * J J P J , K = DK " K K K UM ( bM M * SS 5 ~S S ) S - S ! %T E GT * T T T 3 V / V & W 6 8W % oW W - W - W 4 W 3X BX ] "] 9] L K] 7 ] K ] G ^
d^ o^ |^ 3 ^ ^ ^ { ^ Wb tb D b b ! b c * /c Zc zc ) c ; c c
d ( +d 7 Td j d h k L k ) k S l kl 0 |l l l l % l > m Z Em m m m E n : o ? Po $ o 4 o 7 o "p 7 q - Rq q ' q ' q q 8 q Q 5r + r ( r . r + s H 7s 5 s , s & s
t # t :t Bt Kt Ut
at lt t t N j t * U 4 O z , E e { } | $ M u F s 8 / G H ; h 7 & 1 x W = # L f r - Y D 9 q a ' 2 I b w B [ i K ! " c 6 + v @ J 5 g p n R Z _ % C l ( ? S : V X m 0 ` A d
3 > y
o \ Q ^ . k ) ~ P ] < T
The file is already fully retrieved; nothing to do.
%*s[ skipping %dK ]
CTRL+Break received, redirecting output to `%s'.
Execution continued in background.
You may stop Wget by pressing CTRL+ALT+DELETE.
Continued download failed on this file, which conflicts with `-c'.
Refusing to truncate existing file `%s'.
FINISHED --%s--
Downloaded: %s bytes in %d files
Mandatory arguments to long options are mandatory for short options too.
Originally written by Hrvoje Niksic .
REST failed, starting from scratch.
REST failed; will not truncate `%s'.
(%s bytes) (%s to go) (unauthoritative)
[%s to go] [following] %d redirections exceeded.
%s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld]
%s (%s) - `%s' saved [%ld/%ld])
%s (%s) - `%s' saved [%ld]
%s ERROR %d: %s.
%s received, redirecting output to `%%s'.
%s request sent, awaiting response... %s: %s, closing control connection.
%s: %s: Cannot convert `%s' to an IP address.
%s: %s: Invalid progress type `%s'.
%s: %s: Invalid specification `%s'.
%s: %s: Not enough memory.
%s: %s: Please specify always, on, off, or never.
%s: %s: Please specify on or off.
%s: %s: invalid command
%s: %s:%d: unknown token "%s"
%s: %s:%d: warning: "%s" token appears before any machine name
%s: BUG: unknown command `%s', value `%s'.
%s: Cannot read %s (%s).
%s: Couldn't find usable socket driver.
%s: Error in %s at line %d.
%s: Invalid specification `%s'
%s: Redirection cycle detected.
%s: Warning: Both system and user wgetrc point to `%s'.
%s: cannot stat %s: %s
%s: corrupt time-stamp.
%s: debug support not compiled in.
%s: illegal option -- %c
%s: illegal option -- `-n%c'
%s: missing URL
%s: option `%c%s' doesn't allow an argument
%s: option `%s' is ambiguous
%s: option `%s' requires an argument
%s: option `--%s' doesn't allow an argument
%s: option requires an argument -- %c
%s: unknown/unsupported file type.
%s: unrecognized option `%c%s'
%s: unrecognized option `--%s'
(no description) (try:%2d) ==> CWD not needed.
==> CWD not required.
Already have correct symlink %s -> %s
Authorization failed.
Bind error (%s).
Can't be verbose and quiet at the same time.
Can't timestamp and not clobber old files at the same time.
Cannot back up %s as %s: %s
Cannot convert links in %s: %s
Cannot initiate PASV transfer.
Cannot open cookies file `%s': %s
Cannot parse PASV response.
Cannot write to `%s' (%s).
Connecting to %s:%hu... Connecting to %s[%s]:%hu... Continuing in background.
Control connection closed.
Converted %d files in %.2f seconds.
Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc.
Could not find proxy host.
Could not seed OpenSSL PRNG; disabling SSL.
Creating symlink %s -> %s
Data transfer aborted.
Directories:
-nd --no-directories don't create directories.
-x, --force-directories force creation of directories.
-nH, --no-host-directories don't create host directories.
-P, --directory-prefix=PREFIX save files to PREFIX/...
--cut-dirs=NUMBER ignore NUMBER remote directory components.
Directory Download quota (%s bytes) EXCEEDED!
Download:
--bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host.
-t, --tries=NUMBER set number of retries to NUMBER (0 unlimits).
-O --output-document=FILE write documents to FILE.
-nc, --no-clobber don't clobber existing files or use .# suffixes.
-c, --continue resume getting a partially-downloaded file.
--progress=TYPE select progress gauge type.
-N, --timestamping don't re-retrieve files unless newer than local.
-S, --server-response print server response.
--spider don't download anything.
-T, --timeout=SECONDS set the read timeout to SECONDS.
-w, --wait=SECONDS wait SECONDS between retrievals.
--waitretry=SECONDS wait 1...SECONDS between retries of a retrieval.
--random-wait wait from 0...2*WAIT secs between retrievals.
-Y, --proxy=on/off turn proxy on or off.
-Q, --quota=NUMBER set retrieval quota to NUMBER.
--limit-rate=RATE limit download rate to RATE.
ERROR: Redirection (%d) without location.
End of file while parsing headers.
Error closing `%s': %s
Error in Set-Cookie, field `%s' Error in proxy URL %s: Must be HTTP.
Error in server greeting.
Error in server response, closing control connection.
Error parsing proxy URL %s: %s.
Error writing to `%s': %s
FTP options:
-nr, --dont-remove-listing don't remove `.listing' files.
-g, --glob=on/off turn file name globbing on or off.
--passive-ftp use the "passive" transfer mode.
--retr-symlinks when recursing, get linked-to files (not dirs).
Failed to get certificate key from %s
Failed to load certificates from %s
Failed to set up an SSL context
Failed to unlink symlink `%s': %s
Failed writing HTTP request: %s.
File File `%s' already there, not retrieving.
File `%s' already there, will not retrieve.
GNU Wget %s, a non-interactive network retriever.
Giving up.
HTTP options:
--http-user=USER set http user to USER.
--http-passwd=PASS set http password to PASS.
-C, --cache=on/off (dis)allow server-cached data (normally allowed).
-E, --html-extension save all text/html documents with .html extension.
--ignore-length ignore `Content-Length' header field.
--header=STRING insert STRING among the headers.
--proxy-user=USER set USER as proxy username.
--proxy-passwd=PASS set PASS as proxy password.
--referer=URL include `Referer: URL' header in HTTP request.
-s, --save-headers save the HTTP headers to file.
-U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION.
--no-http-keep-alive disable HTTP keep-alive (persistent connections).
--cookies=off don't use cookies.
--load-cookies=FILE load cookies from FILE before session.
--save-cookies=FILE save cookies to FILE after session.
Host not found Index of /%s on %s:%d Invalid PORT.
Invalid dot style specification `%s'; leaving unchanged.
Invalid name of the symlink, skipping.
Last-modified header invalid -- time-stamp ignored.
Last-modified header missing -- time-stamps turned off.
Length: Length: %s Link Loading robots.txt; please ignore errors.
Location: %s%s
Logged in!
Logging and input file:
-o, --output-file=FILE log messages to FILE.
-a, --append-output=FILE append messages to FILE.
-d, --debug print debug output.
-q, --quiet quiet (no output).
-v, --verbose be verbose (this is the default).
-nv, --non-verbose turn off verboseness, without being quiet.
-i, --input-file=FILE download URLs found in FILE.
-F, --force-html treat input file as HTML.
-B, --base=URL prepends URL to relative links in -F -i file.
--sslcertfile=FILE optional client certificate.
--sslcertkey=KEYFILE optional keyfile for this certificate.
--egd-file=FILE file name of the EGD socket.
Logging in as %s ... Login incorrect.
Mail bug reports and suggestions to .
Malformed status line No URLs found in %s.
No data received No matches on pattern `%s'.
No such directory `%s'.
No such file `%s'.
No such file or directory `%s'.
Not descending to `%s' as it is excluded/not-included.
Not sure Output will be written to `%s'.
Read error (%s) in headers.
Recursion depth %d exceeded max. depth %d.
Recursive accept/reject:
-A, --accept=LIST comma-separated list of accepted extensions.
-R, --reject=LIST comma-separated list of rejected extensions.
-D, --domains=LIST comma-separated list of accepted domains.
--exclude-domains=LIST comma-separated list of rejected domains.
--follow-ftp follow FTP links from HTML documents.
--follow-tags=LIST comma-separated list of followed HTML tags.
-G, --ignore-tags=LIST comma-separated list of ignored HTML tags.
-H, --span-hosts go to foreign hosts when recursive.
-L, --relative follow relative links only.
-I, --include-directories=LIST list of allowed directories.
-X, --exclude-directories=LIST list of excluded directories.
-np, --no-parent don't ascend to the parent directory.
Recursive retrieval:
-r, --recursive recursive web-suck -- use with care!
-l, --level=NUMBER maximum recursion depth (inf or 0 for infinite).
--delete-after delete files locally after downloading them.
-k, --convert-links convert non-relative links to relative.
-K, --backup-converted before converting file X, back up as X.orig.
-m, --mirror shortcut option equivalent to -r -N -l inf -nr.
-p, --page-requisites get all images, etc. needed to display HTML page.
Rejecting `%s'.
Remote file is newer than local file `%s' -- retrieving.
Remote file is newer, retrieving.
Remote file no newer than local file `%s' -- not retrieving.
Removed `%s'.
Removing %s since it should be rejected.
Removing %s.
Resolving %s... Retrying.
Reusing connection to %s:%hu.
Server error, can't determine system type.
Server file no newer than local file `%s' -- not retrieving.
Skipping directory `%s'.
Starting WinHelp %s
Startup:
-V, --version display the version of Wget and exit.
-h, --help print this help.
-b, --background go to background after startup.
-e, --execute=COMMAND execute a `.wgetrc'-style command.
Symlinks not supported, skipping symlink `%s'.
Syntax error in Set-Cookie at character `%c'.
Syntax error in Set-Cookie: premature end of string.
The server refuses login.
The sizes do not match (local %ld) -- retrieving.
The sizes do not match (local %ld) -- retrieving.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
Try `%s --help' for more options.
Trying without the specified certificate
Unable to delete `%s': %s
Unable to establish SSL connection.
Unknown authentication scheme.
Unknown error Unknown type `%c', closing control connection.
Unsupported listing type, trying Unix listing parser.
Usage: %s NETRC [HOSTNAME]
Usage: %s [OPTION]... [URL]...
Using `%s' as listing tmp file.
Warning: wildcards not supported in HTTP.
Will not retrieve dirs since depth is %d (max %d).
Write failed, closing control connection.
Wrote HTML-ized index to `%s' [%ld].
Wrote HTML-ized index to `%s'.
connected.
couldn't connect to %s:%hu: %s
done.
done. done. failed: %s.
ignored nothing to do.
time unknown unspecified Project-Id-Version: wget 1.8
POT-Creation-Date: 2001-12-08 23:28+0100
PO-Revision-Date: 2001-12-10 19:39GMT+0200
Last-Translator: Salvador Gimeno Zann
![Using this option guarantees that recursive retrieval will not span hosts, even without `-H'. In simple cases it also allows downloads to "just work" without having to convert links. This option is probably not very useful and might be removed in a future release. File: wget.info, Node: FTP Links, Prev: Relative Links, Up: Following Links Following FTP Links =================== The rules for FTP are somewhat specific, as it is necessary for them to be. FTP links in HTML documents are often included for purposes of reference, and it is often inconvenient to download them by default. To have FTP links followed from HTML documents, you need to specify the `--follow-ftp' option. Having done that, FTP links will span hosts regardless of `-H' setting. This is logical, as FTP links rarely point to the same host where the HTTP server resides. For similar reasons, the `-L' options has no effect on such downloads. On the other hand, domain acceptance (`-D') and suffix rules (`-A' and `-R') apply normally. Also note that followed links to FTP directories will not be retrieved recursively further. File: wget.info, Node: Time-Stamping, Next: Startup File, Prev: Following Links, Up: Top Time-Stamping ************* One of the most important aspects of mirroring information from the Internet is updating your archives. Downloading the whole archive again and again, just to replace a few changed files is expensive, both in terms of wasted bandwidth and money, and the time to do the update. This is why all the mirroring tools offer the option of incremental updating. Such an updating mechanism means that the remote server is scanned in search of "new" files. Only those new files will be downloaded in the place of the old ones. A file is considered new if one of these two conditions are met: 1. A file of that name does not already exist locally. 2. A file of that name does exist, but the remote file was modified more recently than the local file. To implement this, the program needs to be aware of the time of last modification of both local and remote files. We call this information the "time-stamp" of a file. The time-stamping in GNU Wget is turned on using `--timestamping' (`-N') option, or through `timestamping = on' directive in `.wgetrc'. With this option, for each file it intends to download, Wget will check whether a local file of the same name exists. If it does, and the remote file is older, Wget will not download it. If the local file does not exist, or the sizes of the files do not match, Wget will download the remote file no matter what the time-stamps say. * Menu: * Time-Stamping Usage:: * HTTP Time-Stamping Internals:: * FTP Time-Stamping Internals:: File: wget.info, Node: Time-Stamping Usage, Next: HTTP Time-Stamping Internals, Prev: Time-Stamping, Up: Time-Stamping Time-Stamping Usage =================== The usage of time-stamping is simple. Say you would like to download a file so that it keeps its date of modification. wget -S http://www.gnu.ai.mit.edu/ A simple `ls -l' shows that the time stamp on the local file equals the state of the `Last-Modified' header, as returned by the server. As you can see, the time-stamping info is preserved locally, even without `-N' (at least for HTTP). Several days later, you would like Wget to check if the remote file has changed, and download it if it has. wget -N http://www.gnu.ai.mit.edu/ Wget will ask the server for the last-modified date. If the local file has the same timestamp as the server, or a newer one, the remote file will not be re-fetched. However, if the remote file is more recent, Wget will proceed to fetch it. The same goes for FTP. For example: wget "ftp://ftp.ifi.uio.no/pub/emacs/gnus/*" (The quotes around that URL are to prevent the shell from trying to interpret the `*'.) After download, a local directory listing will show that the timestamps match those on the remote server. Reissuing the command with `-N' will make Wget re-fetch _only_ the files that have been modified since the last download. If you wished to mirror the GNU archive every week, you would use a command like the following, weekly: wget --timestamping -r ftp://ftp.gnu.org/pub/gnu/ Note that time-stamping will only work for files for which the server gives a timestamp. For HTTP, this depends on getting a `Last-Modified' header. For FTP, this depends on getting a directory listing with dates in a format that Wget can parse (*note FTP Time-Stamping Internals::). File: wget.info, Node: HTTP Time-Stamping Internals, Next: FTP Time-Stamping Internals, Prev: Time-Stamping Usage, Up: Time-Stamping HTTP Time-Stamping Internals ============================ Time-stamping in HTTP is implemented by checking of the `Last-Modified' header. If you wish to retrieve the file `foo.html' through HTTP, Wget will check whether `foo.html' exists locally. If it doesn't, `foo.html' will be retrieved unconditionally. If the file does exist locally, Wget will first check its local time-stamp (similar to the way `ls -l' checks it), and then send a `HEAD' request to the remote server, demanding the information on the remote file. The `Last-Modified' header is examined to find which file was modified more recently (which makes it "newer"). If the remote file is newer, it will be downloaded; if it is older, Wget will give up.(1) When `--backup-converted' (`-K') is specified in conjunction with `-N', server file `X' is compared to local file `X.orig', if extant, rather than being compared to local file `X', which will always differ if it's been converted by `--convert-links' (`-k'). Arguably, HTTP time-stamping should be implemented using the `If-Modified-Since' request. ---------- Footnotes ---------- (1) As an additional check, Wget will look at the `Content-Length' header, and compare the sizes; if they are not the same, the remote file will be downloaded no matter what the time-stamp says. File: wget.info, Node: FTP Time-Stamping Internals, Prev: HTTP Time-Stamping Internals, Up: Time-Stamping FTP Time-Stamping Internals =========================== In theory, FTP time-stamping works much the same as HTTP, only FTP has no headers--time-stamps must be ferreted out of directory listings. If an FTP download is recursive or uses globbing, Wget will use the FTP `LIST' command to get a file listing for the directory containing the desired file(s). It will try to analyze the listing, treating it like Unix `ls -l' output, extracting the time-stamps. The rest is exactly the same as for HTTP. Note that when retrieving individual files from an FTP server without using globbing or recursion, listing files will not be downloaded (and thus files will not be time-stamped) unless `-N' is specified. Assumption that every directory listing is a Unix-style listing may sound extremely constraining, but in practice it is not, as many non-Unix FTP servers use the Unixoid listing format because most (all?) of the clients understand it. Bear in mind that RFC959 defines no standard way to get a file list, let alone the time-stamps. We can only hope that a future standard will define this. Another non-standard solution includes the use of `MDTM' command that is supported by some FTP servers (including the popular `wu-ftpd'), which returns the exact time of the specified file. Wget may support this command in the future. File: wget.info, Node: Startup File, Next: Examples, Prev: Time-Stamping, Up: Top Startup File ************ Once you know how to change default settings of Wget through command line arguments, you may wish to make some of those settings permanent. You can do that in a convenient way by creating the Wget startup file--`.wgetrc'. Besides `.wgetrc' is the "main" initialization file, it is convenient to have a special facility for storing passwords. Thus Wget reads and interprets the contents of `$HOME/.netrc', if it finds it. You can find `.netrc' format in your system manuals. Wget reads `.wgetrc' upon startup, recognizing a limited set of commands. * Menu: * Wgetrc Location:: Location of various wgetrc files. * Wgetrc Syntax:: Syntax of wgetrc. * Wgetrc Commands:: List of available commands. * Sample Wgetrc:: A wgetrc example. File: wget.info, Node: Wgetrc Location, Next: Wgetrc Syntax, Prev: Startup File, Up: Startup File Wgetrc Location =============== When initializing, Wget will look for a "global" startup file, `/usr/local/etc/wgetrc' by default (or some prefix other than `/usr/local', if Wget was not installed there) and read commands from there, if it exists. Then it will look for the user's file. If the environmental variable `WGETRC' is set, Wget will try to load that file. Failing that, no further attempts will be made. If `WGETRC' is not set, Wget will try to load `$HOME/.wgetrc'. The fact that user's settings are loaded after the system-wide ones means that in case of collision user's wgetrc _overrides_ the system-wide wgetrc (in `/usr/local/etc/wgetrc' by default). Fascist admins, away! File: wget.info, Node: Wgetrc Syntax, Next: Wgetrc Commands, Prev: Wgetrc Location, Up: Startup File Wgetrc Syntax ============= The syntax of a wgetrc command is simple: variable = value The "variable" will also be called "command". Valid "values" are different for different commands. The commands are case-insensitive and underscore-insensitive. Thus `DIr__PrefiX' is the same as `dirprefix'. Empty lines, lines beginning with `#' and lines containing white-space only are discarded. Commands that expect a comma-separated list will clear the list on an empty command. So, if you wish to reset the rejection list specified in global `wgetrc', you can do it with: reject = File: wget.info, Node: Wgetrc Commands, Next: Sample Wgetrc, Prev: Wgetrc Syntax, Up: Startup File Wgetrc Commands =============== The complete set of commands is listed below. Legal values are listed after the `='. Simple Boolean values can be set or unset using `on' and `off' or `1' and `0'. A fancier kind of Boolean allowed in some cases is the "lockable Boolean", which may be set to `on', `off', `always', or `never'. If an option is set to `always' or `never', that value will be locked in for the duration of the Wget invocation--commandline options will not override. Some commands take pseudo-arbitrary values. ADDRESS values can be hostnames or dotted-quad IP addresses. N can be any positive integer, or `inf' for infinity, where appropriate. STRING values can be any non-empty string. Most of these commands have commandline equivalents (*note Invoking::), though some of the more obscure or rarely used ones do not. accept/reject = STRING Same as `-A'/`-R' (*note Types of Files::). add_hostdir = on/off Enable/disable host-prefixed file names. `-nH' disables it. continue = on/off If set to on, force continuation of preexistent partially retrieved files. See `-c' before setting it. background = on/off Enable/disable going to background--the same as `-b' (which enables it). backup_converted = on/off Enable/disable saving pre-converted files with the suffix `.orig'--the same as `-K' (which enables it). base = STRING Consider relative URLs in URL input files forced to be interpreted as HTML as being relative to STRING--the same as `-B'. bind_address = ADDRESS Bind to ADDRESS, like the `--bind-address' option. cache = on/off When set to off, disallow server-caching. See the `-C' option. convert links = on/off Convert non-relative links locally. The same as `-k'. cookies = on/off When set to off, disallow cookies. See the `--cookies' option. load_cookies = FILE Load cookies from FILE. See `--load-cookies'. save_cookies = FILE Save cookies to FILE. See `--save-cookies'. cut_dirs = N Ignore N remote directory components. debug = on/off Debug mode, same as `-d'. delete_after = on/off Delete after download--the same as `--delete-after'. dir_prefix = STRING Top of directory tree--the same as `-P'. dirstruct = on/off Turning dirstruct on or off--the same as `-x' or `-nd', respectively. domains = STRING Same as `-D' (*note Spanning Hosts::). dot_bytes = N Specify the number of bytes "contained" in a dot, as seen throughout the retrieval (1024 by default). You can postfix the value with `k' or `m', representing kilobytes and megabytes, respectively. With dot settings you can tailor the dot retrieval to suit your needs, or you can use the predefined "styles" (*note Download Options::). dots_in_line = N Specify the number of dots that will be printed in each line throughout the retrieval (50 by default). dot_spacing = N Specify the number of dots in a single cluster (10 by default). exclude_directories = STRING Specify a comma-separated list of directories you wish to exclude from download--the same as `-X' (*note Directory-Based Limits::). exclude_domains = STRING Same as `--exclude-domains' (*note Spanning Hosts::). follow_ftp = on/off Follow FTP links from HTML documents--the same as `--follow-ftp'. follow_tags = STRING Only follow certain HTML tags when doing a recursive retrieval, just like `--follow-tags'. force_html = on/off If set to on, force the input filename to be regarded as an HTML document--the same as `-F'. ftp_proxy = STRING Use STRING as FTP proxy, instead of the one specified in environment. glob = on/off Turn globbing on/off--the same as `-g'. header = STRING Define an additional header, like `--header'. html_extension = on/off Add a `.html' extension to `text/html' files without it, like `-E'. http_passwd = STRING Set HTTP password. http_proxy = STRING Use STRING as HTTP proxy, instead of the one specified in environment. http_user = STRING Set HTTP user to STRING. ignore_length = on/off When set to on, ignore `Content-Length' header; the same as `--ignore-length'. ignore_tags = STRING Ignore certain HTML tags when doing a recursive retrieval, just like `-G' / `--ignore-tags'. include_directories = STRING Specify a comma-separated list of directories you wish to follow when downloading--the same as `-I'. input = STRING Read the URLs from STRING, like `-i'. kill_longer = on/off Consider data longer than specified in content-length header as invalid (and retry getting it). The default behaviour is to save as much data as there is, provided there is more than or equal to the value in `Content-Length'. logfile = STRING Set logfile--the same as `-o'. login = STRING Your user name on the remote machine, for FTP. Defaults to `anonymous'. mirror = on/off Turn mirroring on/off. The same as `-m'. netrc = on/off Turn reading netrc on or off. noclobber = on/off Same as `-nc'. no_parent = on/off Disallow retrieving outside the directory hierarchy, like `--no-parent' (*note Directory-Based Limits::). no_proxy = STRING Use STRING as the comma-separated list of domains to avoid in proxy loading, instead of the one specified in environment. output_document = STRING Set the output filename--the same as `-O'. page_requisites = on/off Download all ancillary documents necessary for a single HTML page to display properly--the same as `-p'. passive_ftp = on/off/always/never Set passive FTP--the same as `--passive-ftp'. Some scripts and `.pm' (Perl module) files download files using `wget --passive-ftp'. If your firewall does not allow this, you can set `passive_ftp = never' to override the commandline. passwd = STRING Set your FTP password to PASSWORD. Without this setting, the password defaults to `username@hostname.domainname'. progress = STRING Set the type of the progress indicator. Legal types are "dot" and "bar". proxy_user = STRING Set proxy authentication user name to STRING, like `--proxy-user'. proxy_passwd = STRING Set proxy authentication password to STRING, like `--proxy-passwd'. referer = STRING Set HTTP `Referer:' header just like `--referer'. (Note it was the folks who wrote the HTTP spec who got the spelling of "referrer" wrong.) quiet = on/off Quiet mode--the same as `-q'. quota = QUOTA Specify the download quota, which is useful to put in the global `wgetrc'. When download quota is specified, Wget will stop retrieving after the download sum has become greater than quota. The quota can be specified in bytes (default), kbytes `k' appended) or mbytes (`m' appended). Thus `quota = 5m' will set the quota to 5 mbytes. Note that the user's startup file overrides system settings. reclevel = N Recursion level--the same as `-l'. recursive = on/off Recursive on/off--the same as `-r'. relative_only = on/off Follow only relative links--the same as `-L' (*note Relative Links::). remove_listing = on/off If set to on, remove FTP listings downloaded by Wget. Setting it to off is the same as `-nr'. retr_symlinks = on/off When set to on, retrieve symbolic links as if they were plain files; the same as `--retr-symlinks'. robots = on/off Use (or not) `/robots.txt' file (*note Robots::). Be sure to know what you are doing before changing the default (which is `on'). server_response = on/off Choose whether or not to print the HTTP and FTP server responses--the same as `-S'. span_hosts = on/off Same as `-H'. timeout = N Set timeout value--the same as `-T'. timestamping = on/off Turn timestamping on/off. The same as `-N' (*note Time-Stamping::). tries = N Set number of retries per URL--the same as `-t'. use_proxy = on/off Turn proxy support on/off. The same as `-Y'. verbose = on/off Turn verbose on/off--the same as `-v'/`-nv'. wait = N Wait N seconds between retrievals--the same as `-w'. waitretry = N Wait up to N seconds between retries of failed retrievals only--the same as `--waitretry'. Note that this is turned on by default in the global `wgetrc'. randomwait = on/off Turn random between-request wait times on or off. The same as `--random-wait'. File: wget.info, Node: Sample Wgetrc, Prev: Wgetrc Commands, Up: Startup File Sample Wgetrc ============= This is the sample initialization file, as given in the distribution. It is divided in two section--one for global usage (suitable for global startup file), and one for local usage (suitable for `$HOME/.wgetrc'). Be careful about the things you change. Note that almost all the lines are commented out. For a command to have any effect, you must remove the `#' character at the beginning of its line. ### ### Sample Wget initialization file .wgetrc ### ## You can use this file to change the default behaviour of wget or to ## avoid having to type many many command-line options. This file does ## not contain a comprehensive list of commands -- look at the manual ## to find out what you can put into this file. ## ## Wget initialization file can reside in /usr/local/etc/wgetrc ## (global, for all users) or $HOME/.wgetrc (for a single user). ## ## To use the settings in this file, you will have to uncomment them, ## as well as change them, in most cases, as the values on the ## commented-out lines are the default values (e.g. "off"). ## ## Global settings (useful for setting up in /usr/local/etc/wgetrc). ## Think well before you change them, since they may reduce wget's ## functionality, and make it behave contrary to the documentation: ## # You can set retrieve quota for beginners by specifying a value # optionally followed by 'K' (kilobytes) or 'M' (megabytes). The # default quota is unlimited. #quota = inf # You can lower (or raise) the default number of retries when # downloading a file (default is 20). #tries = 20 # Lowering the maximum depth of the recursive retrieval is handy to # prevent newbies from going too "deep" when they unwittingly start # the recursive retrieval. The default is 5. #reclevel = 5 # Many sites are behind firewalls that do not allow initiation of # connections from the outside. On these sites you have to use the # `passive' feature of FTP. If you are behind such a firewall, you # can turn this on to make Wget use passive FTP by default. #passive_ftp = off # The "wait" command below makes Wget wait between every connection. # If, instead, you want Wget to wait only between retries of failed # downloads, set waitretry to maximum number of seconds to wait (Wget # will use "linear backoff", waiting 1 second after the first failure # on a file, 2 seconds after the second failure, etc. up to this max). waitretry = 10 ## ## Local settings (for a user to set in his $HOME/.wgetrc). It is ## *highly* undesirable to put these settings in the global file, since ## they are potentially dangerous to "normal" users. ## ## Even when setting up your own ~/.wgetrc, you should know what you ## are doing before doing so. ## # Set this to on to use timestamping by default: #timestamping = off # It is a good idea to make Wget send your email address in a `From:' # header with your request (so that server administrators can contact # you in case of errors). Wget does *not* send `From:' by default. #header = From: Your Name # You can set up other headers, like Accept-Language. Accept-Language # is *not* sent by default. #header = Accept-Language: en # You can set the default proxies for Wget to use for http and ftp. # They will override the value in the environment. #http_proxy = http://proxy.yoyodyne.com:18023/ #ftp_proxy = http://proxy.yoyodyne.com:18023/ # If you do not want to use proxy at all, set this to off. #use_proxy = on # You can customize the retrieval outlook. Valid options are default, # binary, mega and micro. #dot_style = default # Setting this to off makes Wget not download /robots.txt. Be sure to # know *exactly* what /robots.txt is and how it is used before changing # the default! #robots = on # It can be useful to make Wget wait between connections. Set this to # the number of seconds you want Wget to wait. #wait = 0 # You can force creating directory structure, even if a single is being # retrieved, by setting this to on. #dirstruct = off # You can turn on recursive retrieving by default (don't do this if # you are not sure you know what it means) by setting this to on. #recursive = off # To always back up file X as X.orig before converting its links (due # to -k / --convert-links / convert_links = on having been specified), # set this variable to on: #backup_converted = off # To have Wget follow FTP links from HTML files by default, set this # to on: #follow_ftp = off File: wget.info, Node: Examples, Next: Various, Prev: Startup File, Up: Top Examples ******** The examples are divided into three sections loosely based on their complexity. * Menu: * Simple Usage:: Simple, basic usage of the program. * Advanced Usage:: Advanced tips. * Very Advanced Usage:: The hairy stuff. File: wget.info, Node: Simple Usage, Next: Advanced Usage, Prev: Examples, Up: Examples Simple Usage ============ * Say you want to download a URL. Just type: wget http://fly.srk.fer.hr/ * But what will happen if the connection is slow, and the file is lengthy? The connection will probably fail before the whole file is retrieved, more than once. In this case, Wget will try getting the file until it either gets the whole of it, or exceeds the default number of retries (this being 20). It is easy to change the number of tries to 45, to insure that the whole file will arrive safely: wget --tries=45 http://fly.srk.fer.hr/jpg/flyweb.jpg * Now let's leave Wget to work in the background, and write its progress to log file `log'. It is tiring to type `--tries', so we shall use `-t'. wget -t 45 -o log http://fly.srk.fer.hr/jpg/flyweb.jpg & The ampersand at the end of the line makes sure that Wget works in the background. To unlimit the number of retries, use `-t inf'. * The usage of FTP is as simple. Wget will take care of login and password. wget ftp://gnjilux.srk.fer.hr/welcome.msg * If you specify a directory, Wget will retrieve the directory listing, parse it and convert it to HTML. Try: wget ftp://prep.ai.mit.edu/pub/gnu/ links index.html File: wget.info, Node: Advanced Usage, Next: Very Advanced Usage, Prev: Simple Usage, Up: Examples Advanced Usage ============== * You have a file that contains the URLs you want to download? Use the `-i' switch: wget -i FILE If you specify `-' as file name, the URLs will be read from standard input. * Create a five levels deep mirror image of the GNU web site, with the same directory structure the original has, with only one try per document, saving the log of the activities to `gnulog': wget -r http://www.gnu.org/ -o gnulog * The same as the above, but convert the links in the HTML files to point to local files, so you can view the documents off-line: wget --convert-links -r http://www.gnu.org/ -o gnulog * Retrieve only one HTML page, but make sure that all the elements needed for the page to be displayed, such as inline images and external style sheets, are also downloaded. Also make sure the downloaded page references the downloaded links. wget -p --convert-links http://www.server.com/dir/page.html The HTML page will be saved to `www.server.com/dir/page.html', and the images, stylesheets, etc., somewhere under `www.server.com/', depending on where they were on the remote server. * The same as the above, but without the `www.server.com/' directory. In fact, I don't want to have all those random server directories anyway--just save _all_ those files under a `download/' subdirectory of the current directory. wget -p --convert-links -nH -nd -Pdownload \ http://www.server.com/dir/page.html * Retrieve the index.html of `www.lycos.com', showing the original server headers: wget -S http://www.lycos.com/ * Save the server headers with the file, perhaps for post-processing. wget -s http://www.lycos.com/ more index.html * Retrieve the first two levels of `wuarchive.wustl.edu', saving them to `/tmp'. wget -r -l2 -P/tmp ftp://wuarchive.wustl.edu/ * You want to download all the GIFs from a directory on an HTTP server. You tried `wget http://www.server.com/dir/*.gif', but that didn't work because HTTP retrieval does not support globbing. In that case, use: wget -r -l1 --no-parent -A.gif http://www.server.com/dir/ More verbose, but the effect is the same. `-r -l1' means to retrieve recursively (*note Recursive Retrieval::), with maximum depth of 1. `--no-parent' means that references to the parent directory are ignored (*note Directory-Based Limits::), and `-A.gif' means to download only the GIF files. `-A "*.gif"' would have worked too. * Suppose you were in the middle of downloading, when Wget was interrupted. Now you do not want to clobber the files already present. It would be: wget -nc -r http://www.gnu.org/ * If you want to encode your own username and password to HTTP or FTP, use the appropriate URL syntax (*note URL Format::). wget ftp://hniksic:mypassword@unix.server.com/.emacs * You would like the output documents to go to standard output instead of to files? wget -O - http://jagor.srce.hr/ http://www.srce.hr/ You can also combine the two options and make pipelines to retrieve the documents from remote hotlists: wget -O - http://cool.list.com/ | wget --force-html -i - File: wget.info, Node: Very Advanced Usage, Prev: Advanced Usage, Up: Examples Very Advanced Usage =================== * If you wish Wget to keep a mirror of a page (or FTP subdirectories), use `--mirror' (`-m'), which is the shorthand for `-r -l inf -N'. You can put Wget in the crontab file asking it to recheck a site each Sunday: crontab 0 0 * * 0 wget --mirror http://www.gnu.org/ -o /home/me/weeklog * In addition to the above, you want the links to be converted for local viewing. But, after having read this manual, you know that link conversion doesn't play well with timestamping, so you also want Wget to back up the original HTML files before the conversion. Wget invocation would look like this: wget --mirror --convert-links --backup-converted \ http://www.gnu.org/ -o /home/me/weeklog * But you've also noticed that local viewing doesn't work all that well when HTML files are saved under extensions other than `.html', perhaps because they were served as `index.cgi'. So you'd like Wget to rename all the files served with content-type `text/html' to `NAME.html'. wget --mirror --convert-links --backup-converted \ --html-extension -o /home/me/weeklog \ http://www.gnu.org/ Or, with less typing: wget -m -k -K -E http://www.gnu.org/ -o /home/me/weeklog File: wget.info, Node: Various, Next: Appendices, Prev: Examples, Up: Top Various ******* This chapter contains all the stuff that could not fit anywhere else. * Menu: * Proxies:: Support for proxy servers * Distribution:: Getting the latest version. * Mailing List:: Wget mailing list for announcements and discussion. * Reporting Bugs:: How and where to report bugs. * Portability:: The systems Wget works on. * Signals:: Signal-handling performed by Wget. File: wget.info, Node: Proxies, Next: Distribution, Prev: Various, Up: Various Proxies ======= "Proxies" are special-purpose HTTP servers designed to transfer data from remote servers to local clients. One typical use of proxies is lightening network load for users behind a slow connection. This is achieved by channeling all HTTP and FTP requests through the proxy which caches the transferred data. When a cached resource is requested again, proxy will return the data from cache. Another use for proxies is for companies that separate (for security reasons) their internal networks from the rest of Internet. In order to obtain information from the Web, their users connect and retrieve remote data using an authorized proxy. Wget supports proxies for both HTTP and FTP retrievals. The standard way to specify proxy location, which Wget recognizes, is using the following environment variables: `http_proxy' This variable should contain the URL of the proxy for HTTP connections. `ftp_proxy' This variable should contain the URL of the proxy for FTP connections. It is quite common that HTTP_PROXY and FTP_PROXY are set to the same URL. `no_proxy' This variable should contain a comma-separated list of domain extensions proxy should _not_ be used for. For instance, if the value of `no_proxy' is `.mit.edu', proxy will not be used to retrieve documents from MIT. In addition to the environment variables, proxy location and settings may be specified from within Wget itself. `-Y on/off' `--proxy=on/off' `proxy = on/off' This option may be used to turn the proxy support on or off. Proxy support is on by default, provided that the appropriate environment variables are set. `http_proxy = URL' `ftp_proxy = URL' `no_proxy = STRING' These startup file variables allow you to override the proxy settings specified by the environment. Some proxy servers require authorization to enable you to use them. The authorization consists of "username" and "password", which must be sent by Wget. As with HTTP authorization, several authentication schemes exist. For proxy authorization only the `Basic' authentication scheme is currently implemented. You may specify your username and password either through the proxy URL or through the command-line options. Assuming that the company's proxy is located at `proxy.company.com' at port 8001, a proxy URL location containing authorization data might look like this: http://hniksic:mypassword@proxy.company.com:8001/ Alternatively, you may use the `proxy-user' and `proxy-password' options, and the equivalent `.wgetrc' settings `proxy_user' and `proxy_passwd' to set the proxy username and password. File: wget.info, Node: Distribution, Next: Mailing List, Prev: Proxies, Up: Various Distribution ============ Like all GNU utilities, the latest version of Wget can be found at the master GNU archive site prep.ai.mit.edu, and its mirrors. For example, Wget 1.8.1 can be found at File: wget.info, Node: Mailing List, Next: Reporting Bugs, Prev: Distribution, Up: Various Mailing List ============ Wget has its own mailing list at , thanks to Karsten Thygesen. The mailing list is for discussion of Wget features and web, reporting Wget bugs (those that you think may be of interest to the public) and mailing announcements. You are welcome to subscribe. The more people on the list, the better! To subscribe, send mail to . the magic word `subscribe' in the subject line. Unsubscribe by mailing to . The mailing list is archived at . Alternative archive is available at . File: wget.info, Node: Reporting Bugs, Next: Portability, Prev: Mailing List, Up: Various Reporting Bugs ============== You are welcome to send bug reports about GNU Wget to . Before actually submitting a bug report, please try to follow a few simple guidelines. 1. Please try to ascertain that the behaviour you see really is a bug. If Wget crashes, it's a bug. If Wget does not behave as documented, it's a bug. If things work strange, but you are not sure about the way they are supposed to work, it might well be a bug. 2. Try to repeat the bug in as simple circumstances as possible. E.g. if Wget crashes while downloading `wget -rl0 -kKE -t5 -Y0 http://yoyodyne.com -o /tmp/log', you should try to see if the crash is repeatable, and if will occur with a simpler set of options. You might even try to start the download at the page where the crash occurred to see if that page somehow triggered the crash. Also, while I will probably be interested to know the contents of your `.wgetrc' file, just dumping it into the debug message is probably a bad idea. Instead, you should first try to see if the bug repeats with `.wgetrc' moved out of the way. Only if it turns out that `.wgetrc' settings affect the bug, mail me the relevant parts of the file. 3. Please start Wget with `-d' option and send the log (or the relevant parts of it). If Wget was compiled without debug support, recompile it. It is _much_ easier to trace bugs with debug support on. 4. If Wget has crashed, try to run it in a debugger, e.g. `gdb `which wget` core' and type `where' to get the backtrace. File: wget.info, Node: Portability, Next: Signals, Prev: Reporting Bugs, Up: Various Portability =========== Since Wget uses GNU Autoconf for building and configuring, and avoids using "special" ultra-mega-cool features of any particular Unix, it should compile (and work) on all common Unix flavors. Various Wget versions have been compiled and tested under many kinds of Unix systems, including Solaris, Linux, SunOS, OSF (aka Digital Unix), Ultrix, *BSD, IRIX, and others; refer to the file `MACHINES' in the distribution directory for a comprehensive list. If you compile it on an architecture not listed there, please let me know so I can update it. Wget should also compile on the other Unix systems, not listed in `MACHINES'. If it doesn't, please let me know. Thanks to kind contributors, this version of Wget compiles and works on Microsoft Windows 95 and Windows NT platforms. It has been compiled successfully using MS Visual C++ 4.0, Watcom, and Borland C compilers, with Winsock as networking software. Naturally, it is crippled of some features available on Unix, but it should work as a substitute for people stuck with Windows. Note that the Windows port is *neither tested nor maintained* by me--all questions and problems should be reported to Wget mailing list at where the maintainers will look at them. File: wget.info, Node: Signals, Prev: Portability, Up: Various Signals ======= Since the purpose of Wget is background work, it catches the hangup signal (`SIGHUP') and ignores it. If the output was on standard output, it will be redirected to a file named `wget-log'. Otherwise, `SIGHUP' is ignored. This is convenient when you wish to redirect the output of Wget after having started it. $ wget http://www.ifi.uio.no/~larsi/gnus.tar.gz & $ kill -HUP %% # Redirect the output to wget-log Other than that, Wget will not try to interfere with signals in any way. `C-c', `kill -TERM' and `kill -KILL' should kill it alike. File: wget.info, Node: Appendices, Next: Copying, Prev: Various, Up: Top Appendices ********** This chapter contains some references I consider useful. * Menu: * Robots:: Wget as a WWW robot. * Security Considerations:: Security with Wget. * Contributors:: People who helped. File: wget.info, Node: Robots, Next: Security Considerations, Prev: Appendices, Up: Appendices Robots ====== It is extremely easy to make Wget wander aimlessly around a web site, sucking all the available data in progress. `wget -r SITE', and you're set. Great? Not for the server admin. While Wget is retrieving static pages, there's not much of a problem. But for Wget, there is no real difference between a static page and the most demanding CGI. For instance, a site I know has a section handled by an, uh, "bitchin'" CGI script that converts all the Info files to HTML. The script can and does bring the machine to its knees without providing anything useful to the downloader. For such and similar cases various robot exclusion schemes have been devised as a means for the server administrators and document authors to protect chosen portions of their sites from the wandering of robots. The more popular mechanism is the "Robots Exclusion Standard", or RES, written by Martijn Koster et al. in 1994. It specifies the format of a text file containing directives that instruct the robots which URL paths to avoid. To be found by the robots, the specifications must be placed in `/robots.txt' in the server root, which the robots are supposed to download and parse. Wget supports RES when downloading recursively. So, when you issue: wget -r http://www.server.com/ First the index of `www.server.com' will be downloaded. If Wget finds that it wants to download more documents from that server, it will request `http://www.server.com/robots.txt' and, if found, use it for further downloads. `robots.txt' is loaded only once per each server. Until version 1.8, Wget supported the first version of the standard, written by Martijn Koster in 1994 and available at . As of version 1.8, Wget has supported the additional directives specified in the internet draft `' titled "A Method for Web Robots Control". The draft, which has as far as I know never made to an RFC, is available at . This manual no longer includes the text of the Robot Exclusion Standard. The second, less known mechanism, enables the author of an individual document to specify whether they want the links from the file to be followed by a robot. This is achieved using the `META' tag, like this: This is explained in some detail at . Wget supports this method of robot exclusion in addition to the usual `/robots.txt' exclusion. a proxy URL location containing authorization data might look like this: http://hniksic:mypassword@proxy.company.com:8001/ Alternatively, you may use the `proxy-user' an./info/wget.info-3 644 0 0 133202 7445172706 7135 This is wget.info, produced by makeinfo version 4.1 from wget.texi. INFO-DIR-SECTION Net Utilities INFO-DIR-SECTION World Wide Web START-INFO-DIR-ENTRY * Wget: (wget). The non-interactive network downloader. END-INFO-DIR-ENTRY This file documents the the GNU Wget utility for downloading network data. Copyright (C) 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. Permission is granted to make and distribute verbatim copies of this manual provided the copyright notice and this permission notice are preserved on all copies. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with the Invariant Sections being "GNU General Public License" and "GNU Free Documentation License", with no Front-Cover Texts, and with no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License". File: wget.info, Node: Security Considerations, Next: Contributors, Prev: Robots, Up: Appendices Security Considerations ======================= When using Wget, you must be aware that it sends unencrypted passwords through the network, which may present a security problem. Here are the main issues, and some solutions. 1. The passwords on the command line are visible using `ps'. If this is a problem, avoid putting passwords from the command line--e.g. you can use `.netrc' for this. 2. Using the insecure "basic" authentication scheme, unencrypted passwords are transmitted through the network routers and gateways. 3. The FTP passwords are also in no way encrypted. There is no good solution for this at the moment. 4. Although the "normal" output of Wget tries to hide the passwords, debugging logs show them, in all forms. This problem is avoided by being careful when you send debug logs (yes, even when you send them to me). File: wget.info, Node: Contributors, Prev: Security Considerations, Up: Appendices Contributors ============ GNU Wget was written by Hrvoje Niksic . However, its development could never have gone as far as it has, were it not for the help of many people, either with bug reports, feature proposals, patches, or letters saying "Thanks!". Special thanks goes to the following people (no particular order): * Karsten Thygesen--donated system resources such as the mailing list, web space, and FTP space, along with a lot of time to make these actually work. * Shawn McHorse--bug reports and patches. * Kaveh R. Ghazi--on-the-fly `ansi2knr'-ization. Lots of portability fixes. * Gordon Matzigkeit--`.netrc' support. * Zlatko Calusic, Tomislav Vujec and Drazen Kacar--feature suggestions and "philosophical" discussions. * Darko Budor--initial port to Windows. * Antonio Rosella--help and suggestions, plus the Italian translation. * Tomislav Petrovic, Mario Mikocevic--many bug reports and suggestions. * Francois Pinard--many thorough bug reports and discussions. * Karl Eichwalder--lots of help with internationalization and other things. * Junio Hamano--donated support for Opie and HTTP `Digest' authentication. * The people who provided donations for development, including Brian Gough. The following people have provided patches, bug/build reports, useful suggestions, beta testing services, fan mail and all the other things that make maintenance so much fun: Ian Abbott Tim Adam, Adrian Aichner, Martin Baehr, Dieter Baron, Roger Beeman, Dan Berger, T. Bharath, Paul Bludov, Daniel Bodea, Mark Boyns, John Burden, Wanderlei Cavassin, Gilles Cedoc, Tim Charron, Noel Cragg, Kristijan Conkas, John Daily, Andrew Davison, Andrew Deryabin, Ulrich Drepper, Marc Duponcheel, Damir Dzeko, Alan Eldridge, Aleksandar Erkalovic, Andy Eskilsson, Christian Fraenkel, Masashi Fujita, Howard Gayle, Marcel Gerrits, Lemble Gregory, Hans Grobler, Mathieu Guillaume, Dan Harkless, Herold Heiko, Jochen Hein, Karl Heuer, HIROSE Masaaki, Gregor Hoffleit, Erik Magnus Hulthen, Richard Huveneers, Jonas Jensen, Simon Josefsson, Mario Juric, Hack Kampbjorn, Const Kaplinsky, Goran Kezunovic, Robert Kleine, KOJIMA Haime, Fila Kolodny, Alexander Kourakos, Martin Kraemer, Simos KSenitellis, Hrvoje Lacko, Daniel S. Lewart, Nicolas Lichtmeier, Dave Love, Alexander V. Lukyanov, Jordan Mendelson, Lin Zhe Min, Tim Mooney, Simon Munton, Charlie Negyesi, R. K. Owen, Andrew Pollock, Steve Pothier, Jan Prikryl, Marin Purgar, Csaba Raduly, Keith Refson, Tyler Riddle, Tobias Ringstrom, Juan Jose Rodrigues, Edward J. Sabol, Heinz Salzmann, Robert Schmidt, Andreas Schwab, Chris Seawood, Toomas Soome, Tage Stabell-Kulo, Sven Sternberger, Markus Strasser, John Summerfield, Szakacsits Szabolcs, Mike Thomas, Philipp Thomas, Dave Turner, Russell Vincent, Charles G Waldman, Douglas E. Wegscheid, Jasmin Zainul, Bojan Zdrnja, Kristijan Zimmer. Apologies to all who I accidentally left out, and many thanks to all the subscribers of the Wget mailing list. File: wget.info, Node: Copying, Next: Concept Index, Prev: Appendices, Up: Top Copying ******* GNU Wget is licensed under the GNU GPL, which makes it "free software". Please note that "free" in "free software" refers to liberty, not price. As some GNU project advocates like to point out, think of "free speech" rather than "free beer". The exact and legally binding distribution terms are spelled out below; in short, you have the right (freedom) to run and change Wget and distribute it to other people, and even--if you want--charge money for doing either. The important restriction is that you have to grant your recipients the same rights and impose the same restrictions. This method of licensing software is also known as "open source" because, among other things, it makes sure that all recipients will receive the source code along with the program, and be able to improve it. The GNU project prefers the term "free software" for reasons outlined at . The exact license terms are defined by this paragraph and the GNU General Public License it refers to: GNU Wget is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. GNU Wget is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. A copy of the GNU General Public License is included as part of this manual; if you did not receive it, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. In addition to this, this manual is free in the same sense: Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with the Invariant Sections being "GNU General Public License" and "GNU Free Documentation License", with no Front-Cover Texts, and with no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License". The full texts of the GNU General Public License and of the GNU Free Documentation License are available below. * Menu: * GNU General Public License:: * GNU Free Documentation License:: File: wget.info, Node: GNU General Public License, Next: GNU Free Documentation License, Prev: Copying, Up: Copying GNU General Public License ========================== Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 675 Mass Ave, Cambridge, MA 02139, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble ======== The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 1. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 2. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 3. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a. You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b. You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c. If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 4. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a. Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b. Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c. Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 5. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 6. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 7. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 8. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 9. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 10. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 11. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 12. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 13. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs ============================================= If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. ONE LINE TO GIVE THE PROGRAM'S NAME AND AN IDEA OF WHAT IT DOES. Copyright (C) 19YY NAME OF AUTHOR This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19YY NAME OF AUTHOR Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. SIGNATURE OF TY COON, 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. File: wget.info, Node: GNU Free Documentation License, Prev: GNU General Public License, Up: Copying GNU Free Documentation License ============================== Version 1.1, March 2000 Copyright (C) 2000 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. 0. PREAMBLE The purpose of this License is to make a manual, textbook, or other written document "free" in the sense of freedom: to assure everyone the effective freedom to copy and redistribute it, with or without modifying it, either commercially or noncommercially. Secondarily, this License preserves for the author and publisher a way to get credit for their work, while not being considered responsible for modifications made by others. This License is a kind of "copyleft", which means that derivative works of the document must themselves be free in the same sense. It complements the GNU General Public License, which is a copyleft license designed for free software. We have designed this License in order to use it for manuals for free software, because free software needs free documentation: a free program should come with manuals providing the same freedoms that the software does. But this License is not limited to software manuals; it can be used for any textual work, regardless of subject matter or whether it is published as a printed book. We recommend this License principally for works whose purpose is instruction or reference. 1. APPLICABILITY AND DEFINITIONS This License applies to any manual or other work that contains a notice placed by the copyright holder saying it can be distributed under the terms of this License. The "Document", below, refers to any such manual or work. Any member of the public is a licensee, and is addressed as "you". A "Modified Version" of the Document means any work containing the Document or a portion of it, either copied verbatim, or with modifications and/or translated into another language. A "Secondary Section" is a named appendix or a front-matter section of the Document that deals exclusively with the relationship of the publishers or authors of the Document to the Document's overall subject (or to related matters) and contains nothing that could fall directly within that overall subject. (For example, if the Document is in part a textbook of mathematics, a Secondary Section may not explain any mathematics.) The relationship could be a matter of historical connection with the subject or with related matters, or of legal, commercial, philosophical, ethical or political position regarding them. The "Invariant Sections" are certain Secondary Sections whose titles are designated, as being those of Invariant Sections, in the notice that says that the Document is released under this License. The "Cover Texts" are certain short passages of text that are listed, as Front-Cover Texts or Back-Cover Texts, in the notice that says that the Document is released under this License. A "Transparent" copy of the Document means a machine-readable copy, represented in a format whose specification is available to the general public, whose contents can be viewed and edited directly and straightforwardly with generic text editors or (for images composed of pixels) generic paint programs or (for drawings) some widely available drawing editor, and that is suitable for input to text formatters or for automatic translation to a variety of formats suitable for input to text formatters. A copy made in an otherwise Transparent file format whose markup has been designed to thwart or discourage subsequent modification by readers is not Transparent. A copy that is not "Transparent" is called "Opaque". Examples of suitable formats for Transparent copies include plain ASCII without markup, Texinfo input format, LaTeX input format, SGML or XML using a publicly available DTD, and standard-conforming simple HTML designed for human modification. Opaque formats include PostScript, PDF, proprietary formats that can be read and edited only by proprietary word processors, SGML or XML for which the DTD and/or processing tools are not generally available, and the machine-generated HTML produced by some word processors for output purposes only. The "Title Page" means, for a printed book, the title page itself, plus such following pages as are needed to hold, legibly, the material this License requires to appear in the title page. For works in formats which do not have any title page as such, "Title Page" means the text near the most prominent appearance of the work's title, preceding the beginning of the body of the text. 2. VERBATIM COPYING You may copy and distribute the Document in any medium, either commercially or noncommercially, provided that this License, the copyright notices, and the license notice saying this License applies to the Document are reproduced in all copies, and that you add no other conditions whatsoever to those of this License. You may not use technical measures to obstruct or control the reading or further copying of the copies you make or distribute. However, you may accept compensation in exchange for copies. If you distribute a large enough number of copies you must also follow the conditions in section 3. You may also lend copies, under the same conditions stated above, and you may publicly display copies. 3. COPYING IN QUANTITY If you publish printed copies of the Document numbering more than 100, and the Document's license notice requires Cover Texts, you must enclose the copies in covers that carry, clearly and legibly, all these Cover Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on the back cover. Both covers must also clearly and legibly identify you as the publisher of these copies. The front cover must present the full title with all words of the title equally prominent and visible. You may add other material on the covers in addition. Copying with changes limited to the covers, as long as they preserve the title of the Document and satisfy these conditions, can be treated as verbatim copying in other respects. If the required texts for either cover are too voluminous to fit legibly, you should put the first ones listed (as many as fit reasonably) on the actual cover, and continue the rest onto adjacent pages. If you publish or distribute Opaque copies of the Document numbering more than 100, you must either include a machine-readable Transparent copy along with each Opaque copy, or state in or with each Opaque copy a publicly-accessible computer-network location containing a complete Transparent copy of the Document, free of added material, which the general network-using public has access to download anonymously at no charge using public-standard network protocols. If you use the latter option, you must take reasonably prudent steps, when you begin distribution of Opaque copies in quantity, to ensure that this Transparent copy will remain thus accessible at the stated location until at least one year after the last time you distribute an Opaque copy (directly or through your agents or retailers) of that edition to the public. It is requested, but not required, that you contact the authors of the Document well before redistributing any large number of copies, to give them a chance to provide you with an updated version of the Document. 4. MODIFICATIONS You may copy and distribute a Modified Version of the Document under the conditions of sections 2 and 3 above, provided that you release the Modified Version under precisely this License, with the Modified Version filling the role of the Document, thus licensing distribution and modification of the Modified Version to whoever possesses a copy of it. In addition, you must do these things in the Modified Version: A. Use in the Title Page (and on the covers, if any) a title distinct from that of the Document, and from those of previous versions (which should, if there were any, be listed in the History section of the Document). You may use the same title as a previous version if the original publisher of that version gives permission. B. List on the Title Page, as authors, one or more persons or entities responsible for authorship of the modifications in the Modified Version, together with at least five of the principal authors of the Document (all of its principal authors, if it has less than five). C. State on the Title page the name of the publisher of the Modified Version, as the publisher. D. Preserve all the copyright notices of the Document. E. Add an appropriate copyright notice for your modifications adjacent to the other copyright notices. F. Include, immediately after the copyright notices, a license notice giving the public permission to use the Modified Version under the terms of this License, in the form shown in the Addendum below. G. Preserve in that license notice the full lists of Invariant Sections and required Cover Texts given in the Document's license notice. H. Include an unaltered copy of this License. I. Preserve the section entitled "History", and its title, and add to it an item stating at least the title, year, new authors, and publisher of the Modified Version as given on the Title Page. If there is no section entitled "History" in the Document, create one stating the title, year, authors, and publisher of the Document as given on its Title Page, then add an item describing the Modified Version as stated in the previous sentence. J. Preserve the network location, if any, given in the Document for public access to a Transparent copy of the Document, and likewise the network locations given in the Document for previous versions it was based on. These may be placed in the "History" section. You may omit a network location for a work that was published at least four years before the Document itself, or if the original publisher of the version it refers to gives permission. K. In any section entitled "Acknowledgements" or "Dedications", preserve the section's title, and preserve in the section all the substance and tone of each of the contributor acknowledgements and/or dedications given therein. L. Preserve all the Invariant Sections of the Document, unaltered in their text and in their titles. Section numbers or the equivalent are not considered part of the section titles. M. Delete any section entitled "Endorsements". Such a section may not be included in the Modified Version. N. Do not retitle any existing section as "Endorsements" or to conflict in title with any Invariant Section. If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections as invariant. To do this, add their titles to the list of Invariant Sections in the Modified Version's license notice. These titles must be distinct from any other section titles. You may add a section entitled "Endorsements", provided it contains nothing but endorsements of your Modified Version by various parties-for example, statements of peer review or that the text has been approved by an organization as the authoritative definition of a standard. You may add a passage of up to five words as a Front-Cover Text, and a passage of up to 25 words as a Back-Cover Text, to the end of the list of Cover Texts in the Modified Version. Only one passage of Front-Cover Text and one of Back-Cover Text may be added by (or through arrangements made by) any one entity. If the Document already includes a cover text for the same cover, previously added by you or by arrangement made by the same entity you are acting on behalf of, you may not add another; but you may replace the old one, on explicit permission from the previous publisher that added the old one. The author(s) and publisher(s) of the Document do not by this License give permission to use their names for publicity for or to assert or imply endorsement of any Modified Version. 5. COMBINING DOCUMENTS You may combine the Document with other documents released under this License, under the terms defined in section 4 above for modified versions, provided that you include in the combination all of the Invariant Sections of all of the original documents, unmodified, and list them all as Invariant Sections of your combined work in its license notice. The combined work need only contain one copy of this License, and multiple identical Invariant Sections may be replaced with a single copy. If there are multiple Invariant Sections with the same name but different contents, make the title of each such section unique by adding at the end of it, in parentheses, the name of the original author or publisher of that section if known, or else a unique number. Make the same adjustment to the section titles in the list of Invariant Sections in the license notice of the combined work. In the combination, you must combine any sections entitled "History" in the various original documents, forming one section entitled "History"; likewise combine any sections entitled "Acknowledgements", and any sections entitled "Dedications". You must delete all sections entitled "Endorsements." 6. COLLECTIONS OF DOCUMENTS You may make a collection consisting of the Document and other documents released under this License, and replace the individual copies of this License in the various documents with a single copy that is included in the collection, provided that you follow the rules of this License for verbatim copying of each of the documents in all other respects. You may extract a single document from such a collection, and distribute it individually under this License, provided you insert a copy of this License into the extracted document, and follow this License in all other respects regarding verbatim copying of that document. 7. AGGREGATION WITH INDEPENDENT WORKS A compilation of the Document or its derivatives with other separate and independent documents or works, in or on a volume of a storage or distribution medium, does not as a whole count as a Modified Version of the Document, provided no compilation copyright is claimed for the compilation. Such a compilation is called an "aggregate", and this License does not apply to the other self-contained works thus compiled with the Document, on account of their being thus compiled, if they are not themselves derivative works of the Document. If the Cover Text requirement of section 3 is applicable to these copies of the Document, then if the Document is less than one quarter of the entire aggregate, the Document's Cover Texts may be placed on covers that surround only the Document within the aggregate. Otherwise they must appear on covers around the whole aggregate. 8. TRANSLATION Translation is considered a kind of modification, so you may distribute translations of the Document under the terms of section 4. Replacing Invariant Sections with translations requires special permission from their copyright holders, but you may include translations of some or all Invariant Sections in addition to the original versions of these Invariant Sections. You may include a translation of this License provided that you also include the original English version of this License. In case of a disagreement between the translation and the original English version of this License, the original English version will prevail. 9. TERMINATION You may not copy, modify, sublicense, or distribute the Document except as expressly provided for under this License. Any other attempt to copy, modify, sublicense or distribute the Document is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 10. FUTURE REVISIONS OF THIS LICENSE The Free Software Foundation may publish new, revised versions of the GNU Free Documentation License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. See http://www.gnu.org/copyleft/. Each version of the License is given a distinguishing version number. If the Document specifies that a particular numbered version of this License "or any later version" applies to it, you have the option of following the terms and conditions either of that specified version or of any later version that has been published (not as a draft) by the Free Software Foundation. If the Document does not specify a version number of this License, you may choose any version ever published (not as a draft) by the Free Software Foundation. ADDENDUM: How to use this License for your documents ==================================================== To use this License in a document you have written, include a copy of the License in the document and put the following copyright and license notices just after the title page: Copyright (C) YEAR YOUR NAME. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with the Invariant Sections being LIST THEIR TITLES, with the Front-Cover Texts being LIST, and with the Back-Cover Texts being LIST. A copy of the license is included in the section entitled ``GNU Free Documentation License''. If you have no Invariant Sections, write "with no Invariant Sections" instead of saying which ones are invariant. If you have no Front-Cover Texts, write "no Front-Cover Texts" instead of "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. If your document contains nontrivial examples of program code, we recommend releasing these examples in parallel under your choice of free software license, such as the GNU General Public License, to permit their use in free software. Modified Version. N. Do not retitle any existing section as "Endorsements" or to conflict in title with any Invariant Section. If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections./info/wget.info-4 644 0 0 23705 7445172707 7125 This is wget.info, produced by makeinfo version 4.1 from wget.texi. INFO-DIR-SECTION Net Utilities INFO-DIR-SECTION World Wide Web START-INFO-DIR-ENTRY * Wget: (wget). The non-interactive network downloader. END-INFO-DIR-ENTRY This file documents the the GNU Wget utility for downloading network data. Copyright (C) 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. Permission is granted to make and distribute verbatim copies of this manual provided the copyright notice and this permission notice are preserved on all copies. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with the Invariant Sections being "GNU General Public License" and "GNU Free Documentation License", with no Front-Cover Texts, and with no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License". File: wget.info, Node: Concept Index, Prev: Copying, Up: Top Concept Index ************* * Menu: * .html extension: HTTP Options. * .listing files, removing: FTP Options. * .netrc: Startup File. * .wgetrc: Startup File. * accept directories: Directory-Based Limits. * accept suffixes: Types of Files. * accept wildcards: Types of Files. * append to log: Logging and Input File Options. * arguments: Invoking. * authentication: HTTP Options. * backing up converted files: Recursive Retrieval Options. * base for relative links in input file: Logging and Input File Options. * bind() address: Download Options. * bug reports: Reporting Bugs. * bugs: Reporting Bugs. * cache: HTTP Options. * client IP address: Download Options. * clobbering, file: Download Options. * command line: Invoking. * Content-Length, ignore: HTTP Options. * continue retrieval: Download Options. * contributors: Contributors. * conversion of links: Recursive Retrieval Options. * cookies: HTTP Options. * cookies, loading: HTTP Options. * cookies, saving: HTTP Options. * copying: Copying. * cut directories: Directory Options. * debug: Logging and Input File Options. * delete after retrieval: Recursive Retrieval Options. * directories: Directory-Based Limits. * directories, exclude: Directory-Based Limits. * directories, include: Directory-Based Limits. * directory limits: Directory-Based Limits. * directory prefix: Directory Options. * dot style: Download Options. * downloading multiple times: Download Options. * examples: Examples. * exclude directories: Directory-Based Limits. * execute wgetrc command: Basic Startup Options. * features: Overview. * filling proxy cache: Recursive Retrieval Options. * follow FTP links: Recursive Accept/Reject Options. * following ftp links: FTP Links. * following links: Following Links. * force html: Logging and Input File Options. * free software: Copying. * ftp time-stamping: FTP Time-Stamping Internals. * GFDL: Copying. * globbing, toggle: FTP Options. * GPL: Copying. * hangup: Signals. * header, add: HTTP Options. * hosts, spanning: Spanning Hosts. * http password: HTTP Options. * http referer: HTTP Options. * http time-stamping: HTTP Time-Stamping Internals. * http user: HTTP Options. * ignore length: HTTP Options. * include directories: Directory-Based Limits. * incomplete downloads: Download Options. * incremental updating: Time-Stamping. * input-file: Logging and Input File Options. * invoking: Invoking. * IP address, client: Download Options. * latest version: Distribution. * link conversion: Recursive Retrieval Options. * links: Following Links. * list: Mailing List. * loading cookies: HTTP Options. * location of wgetrc: Wgetrc Location. * log file: Logging and Input File Options. * mailing list: Mailing List. * mirroring: Very Advanced Usage. * no parent: Directory-Based Limits. * no warranty: GNU General Public License. * no-clobber: Download Options. * nohup: Invoking. * number of retries: Download Options. * operating systems: Portability. * option syntax: Option Syntax. * output file: Logging and Input File Options. * overview: Overview. * page requisites: Recursive Retrieval Options. * passive ftp: FTP Options. * pause: Download Options. * portability: Portability. * progress indicator: Download Options. * proxies: Proxies. * proxy <1>: HTTP Options. * proxy: Download Options. * proxy authentication: HTTP Options. * proxy filling: Recursive Retrieval Options. * proxy password: HTTP Options. * proxy user: HTTP Options. * quiet: Logging and Input File Options. * quota: Download Options. * random wait: Download Options. * recursion: Recursive Retrieval. * recursive retrieval: Recursive Retrieval. * redirecting output: Advanced Usage. * referer, http: HTTP Options. * reject directories: Directory-Based Limits. * reject suffixes: Types of Files. * reject wildcards: Types of Files. * relative links: Relative Links. * reporting bugs: Reporting Bugs. * required images, downloading: Recursive Retrieval Options. * resume download: Download Options. * retries: Download Options. * retries, waiting between: Download Options. * retrieving: Recursive Retrieval. * robots: Robots. * robots.txt: Robots. * sample wgetrc: Sample Wgetrc. * saving cookies: HTTP Options. * security: Security Considerations. * server maintenance: Robots. * server response, print: Download Options. * server response, save: HTTP Options. * signal handling: Signals. * spanning hosts: Spanning Hosts. * spider: Download Options. * startup: Startup File. * startup file: Startup File. * suffixes, accept: Types of Files. * suffixes, reject: Types of Files. * symbolic links, retrieving: FTP Options. * syntax of options: Option Syntax. * syntax of wgetrc: Wgetrc Syntax. * tag-based recursive pruning: Recursive Accept/Reject Options. * time-stamping: Time-Stamping. * time-stamping usage: Time-Stamping Usage. * timeout: Download Options. * timestamping: Time-Stamping. * tries: Download Options. * types of files: Types of Files. * updating the archives: Time-Stamping. * URL: URL Format. * URL syntax: URL Format. * usage, time-stamping: Time-Stamping Usage. * user-agent: HTTP Options. * various: Various. * verbose: Logging and Input File Options. * wait: Download Options. * wait, random: Download Options. * waiting between retries: Download Options. * Wget as spider: Download Options. * wgetrc: Startup File. * wgetrc commands: Wgetrc Commands. * wgetrc location: Wgetrc Location. * wgetrc syntax: Wgetrc Syntax. * wildcards, accept: Types of Files. * wildcards, reject: Types of Files. HTTP Options. * cookies, loading: ./etc/ 755 0 0 0 7445172710 4637 ./etc/wgetrc 644 0 0 7666 7445172710 6161 ### ### Sample Wget initialization file .wgetrc ### ## You can use this file to change the default behaviour of wget or to ## avoid having to type many many command-line options. This file does ## not contain a comprehensive list of commands -- look at the manual ## to find out what you can put into this file. ## ## Wget initialization file can reside in /usr/local/etc/wgetrc ## (global, for all users) or $HOME/.wgetrc (for a single user). ## ## To use the settings in this file, you will have to uncomment them, ## as well as change them, in most cases, as the values on the ## commented-out lines are the default values (e.g. "off"). ## ## Global settings (useful for setting up in /usr/local/etc/wgetrc). ## Think well before you change them, since they may reduce wget's ## functionality, and make it behave contrary to the documentation: ## # You can set retrieve quota for beginners by specifying a value # optionally followed by 'K' (kilobytes) or 'M' (megabytes). The # default quota is unlimited. #quota = inf # You can lower (or raise) the default number of retries when # downloading a file (default is 20). #tries = 20 # Lowering the maximum depth of the recursive retrieval is handy to # prevent newbies from going too "deep" when they unwittingly start # the recursive retrieval. The default is 5. #reclevel = 5 # Many sites are behind firewalls that do not allow initiation of # connections from the outside. On these sites you have to use the # `passive' feature of FTP. If you are behind such a firewall, you # can turn this on to make Wget use passive FTP by default. #passive_ftp = off # The "wait" command below makes Wget wait between every connection. # If, instead, you want Wget to wait only between retries of failed # downloads, set waitretry to maximum number of seconds to wait (Wget # will use "linear backoff", waiting 1 second after the first failure # on a file, 2 seconds after the second failure, etc. up to this max). waitretry = 10 ## ## Local settings (for a user to set in his $HOME/.wgetrc). It is ## *highly* undesirable to put these settings in the global file, since ## they are potentially dangerous to "normal" users. ## ## Even when setting up your own ~/.wgetrc, you should know what you ## are doing before doing so. ## # Set this to on to use timestamping by default: #timestamping = off # It is a good idea to make Wget send your email address in a `From:' # header with your request (so that server administrators can contact # you in case of errors). Wget does *not* send `From:' by default. #header = From: Your Name # You can set up other headers, like Accept-Language. Accept-Language # is *not* sent by default. #header = Accept-Language: en # You can set the default proxies for Wget to use for http and ftp. # They will override the value in the environment. #http_proxy = http://proxy.yoyodyne.com:18023/ #ftp_proxy = http://proxy.yoyodyne.com:18023/ # If you do not want to use proxy at all, set this to off. #use_proxy = on # You can customize the retrieval outlook. Valid options are default, # binary, mega and micro. #dot_style = default # Setting this to off makes Wget not download /robots.txt. Be sure to # know *exactly* what /robots.txt is and how it is used before changing # the default! #robots = on # It can be useful to make Wget wait between connections. Set this to # the number of seconds you want Wget to wait. #wait = 0 # You can force creating directory structure, even if a single is being # retrieved, by setting this to on. #dirstruct = off # You can turn on recursive retrieving by default (don't do this if # you are not sure you know what it means) by setting this to on. #recursive = off # To always back up file X as X.orig before converting its links (due # to -k / --convert-links / convert_links = on having been specified), # set this variable to on: #backup_converted = off # To have Wget follow FTP links from HTML files by default, set this # to on: #follow_ftp = off Copying. * globbing, toggle: ./share/ 755 0 0 0 7445172711 5167 ./share/locale/ 755 0 0 0 7445172745 6435 ./share/locale/cs/ 755 0 0 0 7445172712 7034 ./share/locale/cs/LC_MESSAGES/ 755 0 0 0 7445172712 10621 ./share/locale/cs/LC_MESSAGES/wget.mo 644 0 0 67045 7445172712 12245 | h i : n E 2 K > 3 % r & ) - . \ & | + ! / * A & l $ . $ 2 ( " [ ~ ? + " ( < e 8 # - Q k , % , & 8 # _ ' 2 I - [ < " # F c : ; W r Y $ * # ! +! C! c! 6 ~! ! ! & " $ # :# " [# ! ~# # ) # , # 2 $ 7$ D$ &( 5( K( Z( ' l( ( 4 ( 8 ( ) &) 1) * >) i) y) ) 5, K, 8 ], , , , , , - ! - 7 A- y- - - - + - . 1 3 : 4 " =4 = `4 4 ) 4 4 4 4 + 5 > <5 {5 5 5 / 6 . 6 5 6 07 2 K7 3 ~7 " 7 ) 7 7 $ 8 ?8 _8 / m8 8 6 8 8 9 -9 * N9 3 y9 9 * 9 % 9 : >: J: Q: Y: c: k: {: : " : ; 8 ; < < 5 += V a= K = 6 > + ;> g> s> > > > ) > - > ? 0 #? 5 T? " ? # ? ? ? 5 @ 2 7@ & j@ ) @ " @ @ _ @ < YA A A U A . $B SB , oB B B ' B H C ) IC ( sC 5 C C # C D " %D # HD $ lD " D % D ' D E E F \F |F " F ( F # F G 'G HG $ eG G G ) G H % I " &I F II J 1 J J 0 N N % O ' :O " bO J O & O O 9 wQ 5 Q " Q 1 R ) H 3 a j h X V Z # A | & = O 8 R u g . n ? ^ 1 < t i N Y , e ' ~ y ` I z T : P [ skipping %dK ] The file is already fully retrieved; nothing to do. CTRL+Break received, redirecting output to `%s'. Execution continued in background. You may stop Wget by pressing CTRL+ALT+DELETE. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. FINISHED --%s-- Downloaded: %s bytes in %d files Mandatory arguments to long options are mandatory for short options too. Originally written by Hrvoje Niksic . REST failed, starting from scratch. REST failed; will not truncate `%s'. (%s bytes) (%s to go) (unauthoritative) [%s to go] [following] %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld] %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - `%s' saved [%ld] %s ERROR %d: %s. %s received, redirecting output to `%%s'. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Cannot convert `%s' to an IP address. %s: %s: Invalid specification `%s'. %s: %s: Not enough memory. %s: %s: Please specify always, on, off, or never. %s: %s: Please specify on or off. %s: %s: invalid command %s: %s:%d: unknown token "%s" %s: %s:%d: warning: "%s" token appears before any machine name %s: BUG: unknown command `%s', value `%s'. %s: Cannot read %s (%s). %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid specification `%s' %s: Redirection cycle detected. %s: Warning: Both system and user wgetrc point to `%s'. %s: cannot stat %s: %s %s: corrupt time-stamp. %s: debug support not compiled in. %s: illegal option -- %c %s: illegal option -- `-n%c' %s: missing URL %s: option `%c%s' doesn't allow an argument %s: option `%s' is ambiguous %s: option `%s' requires an argument %s: option `--%s' doesn't allow an argument %s: option requires an argument -- %c %s: unknown/unsupported file type. %s: unrecognized option `%c%s' %s: unrecognized option `--%s' (no description) (try:%2d) ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot initiate PASV transfer. Cannot open cookies file `%s': %s Cannot parse PASV response. Cannot write to `%s' (%s). Connecting to %s:%hu... Connection to %s:%hu refused. Continuing in background. Control connection closed. Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Could not find proxy host. Creating symlink %s -> %s Data transfer aborted. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. Directory Download quota (%s bytes) EXCEEDED! Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --dot-style=STYLE set retrieval display style. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. ERROR: Redirection (%d) without location. End of file while parsing headers. Error closing `%s': %s Error in Set-Cookie, field `%s' Error in server greeting. Error in server response, closing control connection. Error writing to `%s': %s FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Failed to get certificate key from %s Failed to load certificates from %s Failed to set up an SSL context Failed to unlink symlink `%s': %s Failed writing HTTP request: %s. File File `%s' already there, not retrieving. File `%s' already there, will not retrieve. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. Host not found Index of /%s on %s:%d Invalid PORT. Invalid host name Invalid name of the symlink, skipping. Invalid port specification Last-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %s Link Loading robots.txt; please ignore errors. Location: %s%s Logged in! Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status line No URLs found in %s. No data received No matches on pattern `%s'. No such directory `%s'. No such file `%s'. No such file or directory `%s'. Not descending to `%s' as it is excluded/not-included. Not sure Output will be written to `%s'. Proxy %s: Must be HTTP. Read error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -nh, --no-host-lookup don't DNS-lookup hosts. -np, --no-parent don't ascend to the parent directory. Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Rejecting `%s'. Remote file is newer than local file `%s' -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file `%s' -- not retrieving. Removed `%s'. Removing %s since it should be rejected. Removing %s. Retrying. Reusing connection to %s:%hu. Server error, can't determine system type. Server file no newer than local file `%s' -- not retrieving. Skipping directory `%s'. Starting WinHelp %s Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Symlinks not supported, skipping symlink `%s'. Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. The server refuses login. The sizes do not match (local %ld) -- retrieving. The sizes do not match (local %ld) -- retrieving. Try `%s --help' for more options. Trying without the specified certificate Unable to delete `%s': %s Unable to establish SSL connection. Unknown authentication scheme. Unknown error Unknown type `%c', closing control connection. Unknown/unsupported protocol Unsupported listing type, trying Unix listing parser. Usage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using `%s' as listing tmp file. Warning: wildcards not supported in HTTP. Will not retrieve dirs since depth is %d (max %d). Will try connecting to %s:%hu. Write failed, closing control connection. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. connected! done. done. done. ignored nothing to do. time unknown unspecified Project-Id-Version: GNU wget 1.7 POT-Creation-Date: 2001-06-04 19:39+0200 PO-Revision-Date: 2001-06-05 23:19+0200 Last-Translator: Jan Prikryl Language-Team: Czech MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-2 Content-Transfer-Encoding: 8-bit [ peskakuje se %dK ] Soubor je ji pln penesen, nebude se nic dlat. Stiskli jste CTRL+Break, vstup byl proto pesmrovn do `%s'. Program pokrauje v bhu na pozad. Wget lze zastavit stiskem CTRL+ALT+DELETE. Na peruen stahovn tohoto souboru nelze navzat. Bylo ovem zadno `-c'. Existujc soubor `%s' tedy radji nebude zkrcen. KONEC --%s-- Celkem nateno %s bajt v %d souborech Argumenty, povinn u dlouhch pepna, jsou povinn i pro krtk verze pepna. Pvodnm autorem tohto programu je Hrvoje Niki . Pkaz REST selhal, penos zane od zatku souboru. Pkaz REST selhal, `%s' nebude zkrceno. (%s bajt) (%s zbv) (nen smrodatn) [%s zbv] [nsleduji] %s (%s) - Spojen ukoneno na bajtu %ld. %s (%s) - Spojen ukoneno na bajtu %ld/%ld. %s (%s) - Datov spojen: %s; %s (%s) - Chyba pi ten dat na bajtu %ld (%s). %s (%s) - Chyba pi ten dat na bajtu %ld/%ld (%s). %s (%s) - `%s' uloeno [%ld/%ld] %s (%s) - `%s' uloeno [%ld/%ld]) %s (%s) - `%s' uloen [%ld] %s CHYBA %d: %s. Byl zachycen signl %s, vstup pesmrovn do `%%s'. %s poadavek odesln, program ek na odpov ... %s: %s, dic spojen bude ukoneno. %s: %s: `%s' nelze pevst na IP adresu. %s: %s: Neplatn specifikace `%s' %s: %s: Nen dost pamti. %s: %s: Zadejte prosm `always' (vdy), `on' (zapnuto), `off' (vypnuto), nebo `never' (nikdy). %s: %s: Zadejte prosm `on' (zapnuto) nebo `off' (vypnuto). %s: %s: neplatn pkaz %s: %s:%d: neznm token "%s" %s: %s:%d varovn: token "%s" je uveden jet ped jakmkoliv nzvem potae %s: CHYBA: Neznm pkaz `%s', hodnota `%s'. %s: Nelze pest %s (%s). %s: Nelze najt pouiteln ovlada socket. %s: Chyba v %s na dku %d. %s: Neplatn specifikace `%s' %s: Detekovno zacyklen pesmrovn. %s: Varovn: Globln i uivatelsk wgetrc jsou shodn uloeny v `%s'. %s: voln `stat %s' skonilo chybou: %s %s: asov raztko souboru je poruen. %s: program nebyl zkompilovn s podporou pro ladn. %s: neppustn pepna -- %c %s: neppustn pepna -- `-n%c' %s: chyb URL %s: pepna `%c%s' nem argument %s: pepna `%s' nen jednoznan %s: pepna `%s' vyaduje argument %s: pepna `--%s' nem argument %s: pepna vyaduje argument -- %c %s: neznm/nepodporovan typ souboru. %s: neznm pepna `%c%s' %s: neznm pepna `--%s' (dn popis) (pokus:%2d) ==> CWD nen poteba. ==> CWD nen poteba. Korektn symbolick odkaz %s -> %s ji existuje. Autorizace selhala. Chyba pi operaci "bind" (%s). Program neme bt upovdan a zitcha najednou. Nelze pouvat asov raztka a nemazat pitom star soubory. Nelze zlohovat %s jako %s: %s Nelze pevst odkazy v %s: %s Nelze spustit pasivn penos dat. Nelze otevt soubor s kolky `%s': %s Odpov na PASV nen pochopiteln. Nelze zapsat do `%s' (%s). Navazuje se spojen s %s:%hu... Spojen s %s:%hu odmtnuto. Program pokrauje v bhu na pozad. dic spojen bylo ukoneno. Pevd se %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. Tento program je en v nadji, e bude uiten, avak BEZ JAKKOLI ZRUKY; neposkytuj se ani odvozen zruky PRODEJNOSTI anebo VHODNOSTI PRO URIT EL. Dal podrobnosti hledejte v Obecn veejn licenci GNU. Nelze najt proxy server. Vytv se symbolick odkaz %s -> %s Penos dat byl pedasn ukonen. Adrese: -nd --no-directories nevytv adrese -x, --force-directories vdy vytv adrese -nH, --no-host-directories nevytv adrese s adresou serveru -P, --directory-prefix=PREFIX ukld data do PREFIX/... --cut-dirs=POET nevytv prvnch POET podadres Adres Pekroen limit objemu uloench dat (%s bajt)! Stahovn: --bind-address=ADRESA pouij lokln rozhran s danou adresou (IP nebo jmno) -t, --tries=SLO poet pokus sthnout URL (0 donekonena) -O --output-document=SOUBOR staen dokumenty ukld do tohoto souboru -nc, --no-clobber nepepisuje existujc soubory -c, --continue pokrauje ve stahovn sten penesench dat --dot-style=STYL nastav zpsob zobrazen pi stahovn dat -N, --timestamping nestahuje star soubory (zapne asov raztka) -S, --server-response vypisuje odpovdi serveru --spider nic nestahuje -T, --timeout=SEKUNDY nastav timeout pi ten na tuto hodnotu -w, --wait=POET ped kadm stahovnm pok POET sekund --waitretry=POET ek 1...POET sec ped novm pokusem o staen -Y, --proxy=on/off zapne penos pes proxy (standardn `off') -Q, --quota=BAJT nastav limit objemu uloench dat CHYBA: Pesmrovn (%d) bez udan nov adresy. Hlavika nen pln. Pi uzavrn `%s' nastala chyba: %s Chyba v hlavice Set-Cookie v poli `%s' vodn odpov serveru je chybn. dic spojen bude ukoneno, protoe server odpovdl chybovm hlenm. Pi zpisu do `%s' nastala chyba: %s. Pepnae pro FTP protokol: -nr, --dont-remove-listing nemae soubory `.listing' s obsahy adres -g, --glob=on/off zapne i vypne expanzi olk ve jmnech soubor --passive-ftp pouije pasivn md penosu dat --retr-symlinks v rekurzivnm mdu stahuje i symbolick odkazy na soubory (nikoliv na adrese) Ze souboru `%s' nebylo mon kl k certifiktu nast. SSL certifikty nebylo mon ze souboru `%s' nast. Nebylo mon nastavit SSL kontext Nebylo mon odstranit symbolick odkaz `%s': %s Nebylo mon odeslat HTTP poadavek: %s. Soubor Soubor `%s' je ji zde a nen jej teba penet. Soubor `%s' je ji zde a nebude se znovu penet. GNU Wget %s, program pro neinteraktivn stahovn soubor. Ani posledn pokus nebyl spn. Pepnae pro HTTP: --http-user=UIVATEL uivatelsk jmno pro autorizovan HTTP penos --http-passwd=HESLO heslo pro autorizovan HTTP penos -C, --cache=on/off povol i zake pouit vyrovnvac pamti na stran serveru (implicitn `on') -E, --html-extension ulo dokumenty typu `text/html' s pponou .html --ignore-length ignoruje pole `Content-Length' v hlavice --header=ETZEC pole ETZEC serveru jako soust hlaviek --proxy-user=UIVATEL jmno uivatele vyadovan pro proxy penos --proxy-passwd=HESLO heslo pro proxy penos --referer=URL posl v hlavicce HTTP poadavku `Referer: URL' -s, --save-headers do stahovanho souboru ulo i hlaviky HTTP -U, --user-agent=AGENT msto identifikace `Wget/VERZE' posl v hlavice HTTP poadavku identifikan etzec AGENT --no-http-keep-alive vypne HTTP keep-alive (trval spojen se serverem) --cookies=off nebude pouvat kolky (HTTP cookies) --load-cookies=SOUBOR ped sezenm nate kolky ze souboru SOUBOR --save-cookies=SOUBOR po sezen ulo kolky do souboru SOUBOR Pota nebyl nalezen Obsah /%s na %s:%d Neplatn PORT. Neplatn jmno stroje Peskakuje se symbolick odkaz, nebo nzev odkazu nen platn. Neplatn specifikace portu asov raztko souboru (`time-stamp') bude ignorovno, protoe hlavika "Last-modified" obsahuje neplatn daje. Nelze pout asov raztka (`time-stamps'), protoe v odpovdi serveru schz hlavika "Last-modified". Dlka: Dlka: %s Sym. odkaz Nat se `robots.txt'. Chybov hlen ignorujte, prosm. Pesmrovno na: %s%s Pihleno! Protokolovn a vstupn soubor: -o, --output-file=SOUBOR nzev souboru s protokolem -a, --append-output=SOUBOR protokol se pipoj na konec tohoto souboru -d, --debug vypisuje ladic informace -q, --quiet nevypisuje vbec nic -v, --verbose bude upovdan (implicitn zapnuto) -nv, --non-verbose vypisuje pouze nejdleitj informace -i, --input-file=SOUBOR vchoz URL odkazy nate z tohoto souboru -F, --force-html soubor s URL je v HTML formtu -B, --base=URL pid URL na zatky relat. odkaz pi '-F -i' --sslcertfile=SOUBOR voliteln certifikt klienta --sslcertkey=SOUBOR voliteln soubor kl pro tento certifikt Probh pihlaovn jako %s ... Chyba pi pihlen. Zprvy o chybch a nvrhy na vylepen programu zaslejte na adresu (pouze anglicky). Komente k eskmu pekladu zaslejte na adresu . Odpov serveru m zkomolen stavov dek V souboru `%s' nebyla nalezena dn URL. Nepila dn data Vzorku `%s' nic neodpovd. Adres `%s' neexistuje. Soubor `%s' neexistuje. Soubor i adres `%s' neexistuje. Do adrese `%s' se nesetupuje, protoe tento adres se bu m vynechat nebo nebyl zadn k prochzen. Neznm typ Vstup bude zapsn do `%s'. Proxy %s: Mus bt HTTP. Chyba (%s) pi ten hlaviek. Hloubka rekurze %d pekroila maximln hloubku %d. Omezen pi rekurzi: -A, --accept=SEZNAM seznam povolench extenz soubor -R, --reject=SEZNAM seznam nepovolench extenz soubor -D, --domains=SEZNAM seznam povolench domn --exclude-domains=SEZNAM seznam nepovolench domn --follow-ftp nsleduje FTP odkazy v HTML dokumentech --follow-tags=LIST seznam nsledovanch HTML znaek -G, --ignore-tags=LIST seznam ignorovanch HTML znaek -H, --span-hosts nat dokumenty i z ostatnch server -I, --include-directories=SEZNAM seznam povolench adres -L, --relative nsleduje pouze relativn odkazy -X, --exclude-directories=SEZNAM seznam vylouench adres -nh, --no-host-lookup nevyhledv adresy v DNS -np, --no-parent nesestupuje do rodiovskho adrese Rekurzivn stahovn: -r, --recursive rekurzivn stahovn -- bute opatrn! -l, --level=SLO maximln hloubka rekurze (0 bez limitu) --delete-after po penosu smae staen soubory -k, --convert-links absolutn URL pevee na relativn -K, --backup-converted ped konverz ulo `X' jako `X.orig' -m, --mirror zapne pepnae vhodn pro zrcadlen dat -p, --page-requisites sthne ve nutn pro zobrazen HTML strnky Soubor `%s' se nem stahovat. Vzdlen soubor je novj, ne lokln soubor `%s', a je jej teba sthnout. Lokln soubor je star a vzdlen soubor se proto bude penet. Vzdlen soubor nen novj, ne lokln soubor `%s', a nen jej teba stahovat. Soubor `%s' byl vymazn. Mae se %s, protoe tento soubor nen poadovn. Mae se %s. Zkus se to znovu. Program vyuije existujc spojen s %s:%hu. Nelze zjistit typ vzdlenho operanho systmu, protoe server odpovdl chybovm hlenm. Lokln soubor `%s' nen star, ne vzdlen soubor, a nen jej teba stahovat. Adres `%s' bude vynechn. Spout se WinHelp %s Zatek: -V, --version vype informaci o verzi programu Wget a skon -h, --help vype tuto npovdu -b, --background po sputn pokrauje program v bhu na pozad -e, --execute=PKAZ provee pkaz zadan ve stylu `.wgetrc' Symbolick odkaz `%s' bude vynechn, protoe systm symbolick odkazy nepodporuje. Syntaktick chyba v hlavice Set-Cookie na znaku `%c'. Syntaktick chyba v hlavice Set-Cookie: Pedasn konec etzce. Server odmt pihlen. Velikosti se neshoduj (lokln %ld), soubor je teba sthnout. Velikosti se neshoduj (lokln %ld), soubor je teba sthnout. Pkaz `%s --help' vype vznam platnch pepna. Program se pokus pokraovat bez zadanho certifiktu. Nebylo mon odstranit `%s': %s Nebylo mon navzat SSL spojen. Server poaduje neznm zpsob autentifikace. Neznm chyba Rdic spojen bude ukoneno, protoe je poadovn neznm typ penosu `%c'. Neznm/nepodporovan protokol Nepodporovan typ vpisu, pouije se Unixov parser. Pouit: %s NETRC [NZEV POTAE] Pouit: %s [PEPNA]... [URL]... Seznam soubor bude doasn uloen v `%s'. Varovn: HTTP nepodporuje olkov znaky. Podadrese se nebudou penet, protoe ji bylo dosaeno hloubky %d (maximum je %d). Program se pokus spojit s %s:%hu. Rdic spojen bude ukoneno, protoe nelze zapsat data. Vpis adrese v HTML formtu byl zapsn do `%s' [%ld]. Vpis adrese v HTML formtu byl zapsn do `%s'. spojeno! hotovo. hotovo. hotovo. je ignorovna nic nen poteba pevdt. as neznm neudno novm pokusem o staen -Y, --proxy=on/off zapne penos pes proxy (standardn `off') -Q, --quota=BAJT nastav limit objemu uloench dat CHYBA: Pesmrovn (%d) bez udan nov adresy. Hlavika nen pln. Pi uzavrn `%s' nastala chyba: %s Chyba v hlavice Set-Cookie v poli `%s' vodn odpov serveru je chybn. dic spojen bude ukoneno, protoe server odpovdl chybovm hlenm. Pi zpisu do `%s' nastala chyba: %s. Pepnae./share/locale/da/ 755 0 0 0 7445172713 7014 ./share/locale/da/LC_MESSAGES/ 755 0 0 0 7445172713 10601 ./share/locale/da/LC_MESSAGES/wget.mo 644 0 0 64374 7445172713 12227 | h i : n E 2 K > 3 % r & ) - . \ & | + ! / * A & l $ . $ 2 ( " [ ~ ? + " ( < e 8 # - Q k , % , & 8 # _ ' 2 I - [ < " # F c : ; W r Y $ * # ! +! C! c! 6 ~! ! ! & " $ # :# " [# ! ~# # ) # , # 2 $ 7$ D$ &( 5( K( Z( ' l( ( 4 ( 8 ( ) &) 1) * >) i) y) ) 5, K, 8 ], , , , , , - ! - 7 A- y- - - - + - . 1 3 : 4 " =4 = `4 4 ) 4 4 4 4 + 5 > <5 {5 5 5 / 6 . 6 5 6 07 2 K7 3 ~7 " 7 ) 7 7 $ 8 ?8 _8 / m8 8 6 8 8 9 -9 * N9 3 y9 9 * 9 % 9 : >: J: Q: Y: c: k: {: : . : ; B ; ,< y < - 1= L _= ? = = * > 8> C> Q> f> t> + > / > > % > ) %? O? o? ? ? / ? ( ? $ @ 1 :@ # l@ @ < @ ) @ A /A : NA , A A ' A A B 6B @ UB B B E B C /C LC + ^C C # C + C $ C * D HD `D xD D D D - D D E / $E M TE ) E $ E " E ! F $ 6F [F {F F F F F F H (H GH w `H I # I J ' M 0 N KN iN " N 4 N N . O % /P ' UP }P - P - P P , Q 7 4Q 3 lQ Q ; Q U U V V - 8V fV 9 V : V V W W 5 W RW ^W kW &Z =Z 7 SZ Z Z Z $ Z Z [ ( 4[ ; ][ [ # [ ! [ [ 0 \ :\ . _ (b 0 9b ! jb 7 b b % b b c " c * 8c 8 cc c c c 4 d * d 8 e # Ve 2 ze 2 e ! e # f &f % @f ff f . f ' f A f +g Gg * dg . g 0 g g 0 h - ?h ' mh h h h h h h h h f d o ( Q 2 L * C _ x w " K v p D 6 - E F 9 b 5 $ M / s S ; ! J l } k + U B 7 [ % 0 G \ r @ { W c m ] 4 ) q > H 3 a j h X V Z # A | & = O 8 R u g . n ? ^ 1 < t i N Y , e ' ~ y ` I z T : P [ skipping %dK ] The file is already fully retrieved; nothing to do. CTRL+Break received, redirecting output to `%s'. Execution continued in background. You may stop Wget by pressing CTRL+ALT+DELETE. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. FINISHED --%s-- Downloaded: %s bytes in %d files Mandatory arguments to long options are mandatory for short options too. Originally written by Hrvoje Niksic . REST failed, starting from scratch. REST failed; will not truncate `%s'. (%s bytes) (%s to go) (unauthoritative) [%s to go] [following] %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld] %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - `%s' saved [%ld] %s ERROR %d: %s. %s received, redirecting output to `%%s'. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Cannot convert `%s' to an IP address. %s: %s: Invalid specification `%s'. %s: %s: Not enough memory. %s: %s: Please specify always, on, off, or never. %s: %s: Please specify on or off. %s: %s: invalid command %s: %s:%d: unknown token "%s" %s: %s:%d: warning: "%s" token appears before any machine name %s: BUG: unknown command `%s', value `%s'. %s: Cannot read %s (%s). %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid specification `%s' %s: Redirection cycle detected. %s: Warning: Both system and user wgetrc point to `%s'. %s: cannot stat %s: %s %s: corrupt time-stamp. %s: debug support not compiled in. %s: illegal option -- %c %s: illegal option -- `-n%c' %s: missing URL %s: option `%c%s' doesn't allow an argument %s: option `%s' is ambiguous %s: option `%s' requires an argument %s: option `--%s' doesn't allow an argument %s: option requires an argument -- %c %s: unknown/unsupported file type. %s: unrecognized option `%c%s' %s: unrecognized option `--%s' (no description) (try:%2d) ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot initiate PASV transfer. Cannot open cookies file `%s': %s Cannot parse PASV response. Cannot write to `%s' (%s). Connecting to %s:%hu... Connection to %s:%hu refused. Continuing in background. Control connection closed. Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Could not find proxy host. Creating symlink %s -> %s Data transfer aborted. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. Directory Download quota (%s bytes) EXCEEDED! Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --dot-style=STYLE set retrieval display style. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. ERROR: Redirection (%d) without location. End of file while parsing headers. Error closing `%s': %s Error in Set-Cookie, field `%s' Error in server greeting. Error in server response, closing control connection. Error writing to `%s': %s FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Failed to get certificate key from %s Failed to load certificates from %s Failed to set up an SSL context Failed to unlink symlink `%s': %s Failed writing HTTP request: %s. File File `%s' already there, not retrieving. File `%s' already there, will not retrieve. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. Host not found Index of /%s on %s:%d Invalid PORT. Invalid host name Invalid name of the symlink, skipping. Invalid port specification Last-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %s Link Loading robots.txt; please ignore errors. Location: %s%s Logged in! Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status line No URLs found in %s. No data received No matches on pattern `%s'. No such directory `%s'. No such file `%s'. No such file or directory `%s'. Not descending to `%s' as it is excluded/not-included. Not sure Output will be written to `%s'. Proxy %s: Must be HTTP. Read error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -nh, --no-host-lookup don't DNS-lookup hosts. -np, --no-parent don't ascend to the parent directory. Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Rejecting `%s'. Remote file is newer than local file `%s' -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file `%s' -- not retrieving. Removed `%s'. Removing %s since it should be rejected. Removing %s. Retrying. Reusing connection to %s:%hu. Server error, can't determine system type. Server file no newer than local file `%s' -- not retrieving. Skipping directory `%s'. Starting WinHelp %s Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Symlinks not supported, skipping symlink `%s'. Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. The server refuses login. The sizes do not match (local %ld) -- retrieving. The sizes do not match (local %ld) -- retrieving. Try `%s --help' for more options. Trying without the specified certificate Unable to delete `%s': %s Unable to establish SSL connection. Unknown authentication scheme. Unknown error Unknown type `%c', closing control connection. Unknown/unsupported protocol Unsupported listing type, trying Unix listing parser. Usage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using `%s' as listing tmp file. Warning: wildcards not supported in HTTP. Will not retrieve dirs since depth is %d (max %d). Will try connecting to %s:%hu. Write failed, closing control connection. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. connected! done. done. done. ignored nothing to do. time unknown unspecified Project-Id-Version: wget 1.7.1-pre1 POT-Creation-Date: 2001-06-03 15:27+0200 PO-Revision-Date: 2001-10-26 19:53-0200 Last-Translator: Keld Jrn Simonsen Language-Team: Danish MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit [ hopper over %dK ] Filen er allerede fuldt overfrt; ingen handling ndvendig. CTRL+Break modtaget, omdirigerer udskrifter til `%s'. Krsel fortstter i baggrunden. Du kan stoppe Wget ved at trykke CTRL+ALT+DELETE. Fortsat hentning mislykkedes for denne fil, hvilket er i modstning til '-c'. Ngter at afkorte eksisterende fil '%s'. FRDIG --%s-- Nedhentede %s byte i %d filer Obligatoriske argumenter til lange flag er obligatoriske ogs for korte. Oprindeligt skrevet af Hrvoje Niksic . Fejl ved REST, starter forfra. REST mislykkedes; vil ikke afkorte '%s'. (%s byte) (%s tilbage) (ikke endegyldigt) [%s tilbage] [omdirigeret] %s (%s) - Forbindelse lukket ved byte %ld. %s (%s) - Forbindelse lukket ved byte %ld/%ld. %s (%s) - dataforbindelse: %s; %s (%s) - Lsefejl ved byte %ld (%s). %s (%s) - Lsefejl ved byte %ld/%ld (%s). %s (%s) - '%s' gemt [%ld/%ld] %s (%s) - '%s' gemt [%ld/%ld] %s (%s) - '%s' gemt [%ld] %s FEJL %d: %s. %s modtaget, omdirigerer udskrifter til '%%s'. %s foresprgsel sendt, afventer svar... %s: %s, lukker kontrolforbindelsen. %s: %s: Kan ikke omforme '%s' til en IP-adresse. %s: %s: Ugyldig specifikation '%s' %s: %s: Ikke nok hukommelse. %s: %s: Venligst angiv 'always', 'on' 'off', eller 'never'. %s: %s: Venligst angiv 'on' eller 'off'. %s: %s: ugyldig kommando %s: %s:%d: ukendt symbol '%s' %s: %s:%d: Advarsel: symbolet '%s' fundet fr server-navn %s: FEJL: Ukendt kommando '%s', vrdi '%s'. %s: Kan ikke lse %s (%s). %s: Fandt ingen brugbar sokkel-driver. %s: Fejl i %s p linje %d. %s: Ugyldig specifikation '%s' %s: Omdirigerer lber i ring. %s: Advarsel: Bde systemets og brugerens wgetrc peger p '%s'. %s: 'stat' fejlede for %s: %s %s: ugyldigt tidsstempel. %s: understttelse for fejlsgning ikke inkluderet ved oversttelse. %s: ugyldigt flag -- %c %s: ugyldigt flag -- '-n%c' %s: URL mangler. %s: flaget '%c%s' tillader ikke argumenter %s: flaget '%s' er flertydig %s: flaget '%s' krver et argument %s: flaget '--%s' tillader ikke argumenter %s: flaget krver et argument -- %c %s: filtypen er ukendt/ikke understttet. %s: ukendt flag '%c%s' %s: ukendt flag '--%s' (ingen beskrivelse) (forsg:%2d) ==> CWD ikke ndvendig. ==> CWD ikke ndvendig. Har allerede gyldig symbolsk lnke %s -> %s Autorisation mislykkedes Bind-fejl (%s). Kan ikke vre udfrlig og stille p samme tid. Kan ikke tidsstemple og lade vre at berre eksisterende filer p samme tid. Kan ikke sikkerhedskopiere %s som %s: %s Kan ikke konvertere lnker i %s: %s Kan ikke opstte PASV-overfrsel. Kan ikke bne infokagefil %s: %s Kan ikke tolke PASV-tilbagemelding. Kan ikke skrive til '%s' (%s). Kontakter %s:%hu... Kontakt med %s:%hu ngtet. Fortstter i baggrunden. Forbindelsen lukket. Konverterer %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. Dette program distribueres i hb om at det bliver fundet nyttigt, men UDEN NOGEN GARANTIER; ikke engang for SALGBARHED eller EGNETHED TIL NOGEN SPECIEL OPGAVE. Se 'GNU General Public License' for detaljer. Fandt ikke proxy-server. Laver symbolsk lnke %s -> %s Dataoverfrsel afbrudt. Kataloger: -nd --no-directories lav ikke kataloger. -x, --force-directories lav kataloger. -nH, --no-host-directories lav ikke ovenstende kataloger. -P, --directory-prefix=PRFIKS skriv filer til PRFIKS/... --cut-dirs=ANTAL ignorr ANTAL komponenter af serverens katalognavn. Katalog Hente-kvote (%s byte) overskredet! Hentning: --bind-address=ADRESSE bind til ADRESSE (vrtsnavn eller IP) p lokal vrt. -t, --tries=ANTAL maksimalt antal forsg (0 for uendelig). -O --output-document=FIL skriv dokumenter til FIL. -nc, --no-clobber berr ikke eksisterende filer, eller brug .#-endelser. -c, --continue fortst hentning af en eksisterende fil. --dot-style=TYPE vlg format for nedlastings-status. -N, --timestamping hent ikke filer igen som er ldre end eksisterende. -S, --server-response vis svar fra serveren. --spider hent ikke filer. -T, --timeout=SEKUNDER st ventetid ved lsning til SEKUNDER. -w, --wait=SEKUNDER st ventetid mellem filer til SEKUNDER. --waitretry=SEKUNDER wait 1...SEKUNDER mellem forsg p gentagelse af en hentning. -Y, --proxy=on/off sl brug af proxy til eller fra. -Q, --quota=ANTAL st hente-kvote til ANTAL. FEJL: Omdirigering (%d) uden nyt sted. Filafslutning fundet ved lsning af toptekster. Fejl ved lukning af '%s': %s fejl ved Set-Cookie, felt '%s' Fejl i velkomsthilsen fra server. Fejl i svar fra server, lukker kontrolforbindelsen. Fejl ved skrivning til '%s' %s FTP-flag: -nr, --dont-remove-listing fjern ikke `.listing' filer. -g, --glob=on/off tolk (ikke) brug af jokertegn i filnavn. --passive-ftp brug passiv overfrselsmetode. --retr-symlinks hent filer (ikke kataloger) der er lnket til, ved rekursiv brug. Kunne ikke f certifikatngle fra %s Kunne ikke indlse certifikater fra %s Kunne ikke opstte et SSL-milj Kan ikke slette den symbolske lnke '%s': %s Fejl ved skrivning af HTTP-foresprgsel: %s. Fil File '%s' eksisterer allerede, hentes ikke. Filen '%s' hentes ikke, fordi den allerede eksisterer. GNU Wget %s, en ikke-interaktiv informationsagent. Giver op. HTTP-flag: --http-user=BRUGER st HTTP-bruger til BRUGER. --http-passwd=PASSORD st HTTP-adgangskode til PASSORD. -C, --cache=on/off tillad (ikke) brug af mellemlager p server. -E, --html-extension gem alle tekst/html dokumenter med .html filkode. --ignore-length ignorer 'Content-Length' felt i toptekst. --header=TEKST st TEKST ind som en toptekst. --proxy-user=BRUGER st proxy-bruger til BRUGER. --proxy-passwd=PASSORD st proxy-adgangskode til PASSORD. --referer=URL brug `Referer: URL' kommando i HTTP-foresprgsel. -s, --save-headers skriv HTTP-toptekster til fil. -U, --user-agent=AGENT identificer som AGENT i stedet for 'Wget/VERSION'. --no-http-keep-alive deaktivr HTTP keep-alive (overlevende forbindelser). --cookies=off brug ikke infokager. --load-cookies=FILE indls infokager fra FIL fr session. --save-cookies=FILE gem infokager i FIL efter session. Vrt ikke fundet Indeks for /%s p %s:%d Ugyldig PORT. Vrtsnavnet er ugyldigt Ugyldigt navn for symbolsk lnke, ignoreres. Port-specifikationen er ugyldig Last-modified toptekst ugyldig -- tidsstempel ignoreret. Last-modified toptekst mangler -- tidsstempling sls fra. Lngde: Lngde: %s Link Henter robots.txt; ignorer eventuelle fejlmeldinger. Sted: %s%s Logget ind! Udskrifter og indlsning: -o, --output-file=FIL skriv beskeder til FIL. -a, --append-output=FIL tilfj beskeder til slutningen af FIL. -d, --debug skriv fejlfindingsinformation. -q, --quiet stille (ingen udskrifter). -v, --verbose vr udfrlig (standard). -nv, --non-verbose mindre udfrlig, men ikke stille. -i, --input-file=FIL ls URLer fra FIL. -F, --force-html ls inddatafil som HTML. -B, --base=URL foranstiller URL til relative lnker i -F -i fil. --sslcertfile=FIL valgbart klient-certifikat. --sslcertkey=NGLEFIL valgbar nglefil for dette certifikat. Logger ind som %s ... Fejl ved indlogging. Rapportr fejl og send forslag til . Forkert udformet statuslinje Fandt ingen URLer i %s. Ingen data modtaget Ingenting passer med mnstret '%s'. Intet katalog ved navn '%s'. Ingen fil ved navn '%s'. Ingen fil eller katalog ved navn '%s'. Behandler ikke '%s' da det er ekskluderet/ikke inkluderet. Usikker Uddata vil blive skrevet til '%s'. Proxy %s: Skal understtte HTTP. Lsefejl (%s) i toptekster. Rekursionsdybde %d overskred maksimal dybde %d. Hvad er tilladt ved rekursion: -A, --accept=LISTE liste med tilladte filtyper. -R, --reject=LISTE liste med ikke-tilladte filtyper. -D, --domains=LISTE liste med tilladte domner. --exclude-domains=LISTE liste med ikke-tilladte domner. --follow-ftp flg FTP-lnker fra HTML-dokumenter. --follow-tags=LIST komma-separeret liste af fulgte HTML-mrker. -G, --ignore-tags=LIST komma-separeret liste af ignorerede HTML-mrker. -H, --span-hosts flg lnker til andre vrter. -L, --relative flg kun relative lnker. -I, --include-directories=LISTE liste med tilladte katalognavne. -X, --exclude-directories=LISTE liste med ikke-tilladte katalognavne. -nh, --no-host-lookup led ikke efter vrtsnavn via DNS. -np, --no-parent flg ikke lnke til ovenliggende katalog. Rekursiv nedlasting: -r, --recursive tillad rekursiv nedlasting -- brug med omtanke! -l, --level=ANTAL maksimalt antal rekursionsniveauer (0=uendelig). --delete-after slet hentede filer. -k, --convert-links konverter absolutte lnker til relative. -K, --backup-converted fr fil X konverteres, sikkerhedskopir som X.orig. -m, --mirror st passende flag for spejling af servere. -p, --page-requisites hent alle billeder osv. der er ndvendige for at vise HTML siden. Ignorerer '%s'. Fjernfil er nyere end lokal fil '%s' - hentes. Fil p server er nyere - hentes. Fjernfil ikke nyere end lokal fil '%s' - hentes ikke. Slettet '%s'. Fjerner %s fordi den skal forkastes. Fjerner %s. Prver igen. Genbruger forbindelse til %s:%hu. Serverfejl, kan ikke bestemme systemtype. Serverfil ikke nyere end lokal fil '%s' - hentes ikke. Ignorerer katalog '%s'. Starter WinHelp %s Opstart: -V, --version vis Wget's versionsnummer og afslut. -h, --help udskriv denne hjlpetekst. -b, --background kr i baggrunden efter opstart. -e, --execute=KOMMANDO udfr en '.wgetrc'-kommando. Symbolske lnker ikke understttet, ignorerer '%s'. Syntaksfejl i Set-Cookie ved tegnet '%c'. Syntaksfejl i Set-Cookie: streng afsluttet for tidligt. Serveren tillader ikke indlogning. Strrelserne er forskellige (lokal %ld) - hentes. Strrelserne er forskellige (lokal %ld) - hentes. Prv '%s --help' for flere flag. Prver uden det angivne certifikat Kan ikke slette '%s': %s Kunne ikke etablere SSL-forbindelse. Ukendt autorisations-protokol. Ukendt fejl Ukendt type '%c', lukker kontrolforbindelsen. Protokollen er ukendt/ikke understttet Ikke-understttet listningstype, prver Unix-listningsfortolker. Brug: %s NETRC [VRTSNAVN] Brug: %s [FLAG]... [URL]... Bruger '%s' som midlertidig katalogliste. Advarsel: jokertegn ikke understttet i HTTP. Henter ikke kataloger, da dybde er %d (max %d). Vil prve at kontakte %s:%hu. Fejl ved skrivning, lukker kontrolforbindelsen. Skrev HTML-formateret indeks til '%s' [%ld]. Skrev HTML-formateret indeks til '%s'. kontakt! O.k. O.k. frdig. ignoreret ingenting at gre. ukendt tid uspecificeret v ikke ovenstende kataloger. -P, --directory-prefix=PRFIKS skriv filer til PRFIKS/... --cut-dirs=ANTAL ignorr ANTAL komponenter af serverens katalognavn. Katalog Hente-kvote (%s byte) overs./share/locale/de/ 755 0 0 0 7445172714 7021 ./share/locale/de/LC_MESSAGES/ 755 0 0 0 7445172714 10606 ./share/locale/de/LC_MESSAGES/wget.mo 644 0 0 73462 7445172714 12232 : n 2 K @ > % & $ 0 D P ] ) x - & + C ! d * & $ . , $ [ $ 2 " 0 ? O + ( ; 8 \ # " , 3 ` % ~ , & # < \ m w ' - < " _ | " 1 N i $ P , ) V q Y $ O * e! # ! ! ! % ! " 6 -" d" " " & # $ # $ " +$ ! N$ p$ ) }$ , $ 2 $ % % ( ) ) 9 *) ' d) 4 ) 8 ) ) * * * * F* V* b* M- c- 8 u- - - - - . ". ! 7. 7 Y. . . . + . / 2 4 : 4 " 5 = #5 a5 ) p5 5 5 5 5 + 5 > 6 O6 i6 ~6 / o7 . 7 5 7 8 2 8 3 R8 8 " q9 ) 9 9 $ 9 9 : / ,: 6 \: : : : * : 3 ; * O; % z; ; ; ; ; ; ; < < < *< >< ! J< E l= = = > / &? Y V? E ? 5 ? 2 ,@ _@ k@ v@ @ @ ) @ / @ 3 @ (A ' IA , qA & A ' A " A B * #B . NB ' }B 7 B ) B C ! &C 0 HC ' yC C % C E C ( (D QD / nD ! D D % D F E HE fE - E E E E ( E 'F & GF ( nF ' F 3 F ! F ! G 7G LG ZG tG ? G G G A H M LH : H ' H & H 1 $I # VI % zI I # I I ! J ) %J OJ P gJ J T J ' +K SK sK HM * UM M % ~S 2 S $ S S : T & XT A T + T % T U 9 V ) V ) W = 1W 0 oW W < W 8 W L #X pX ~X ] ] ] D ] > ^ > S^ = ^ ^ ^ ^ , ^ _ )_ Z 6_ b b b ]c xc c # c % c c 4 d P Id d $ d ( d > d ] 4e j ]m L sm 3 m M m Bn 3 Rn n n n + n M n N Eo o o o L p / q = Cq % q ? q @ q K (r ( ts ) s * s 8 s & +t Rt 3 et M t t u . %u : Tu Q u 6 u . v * Gv rv 3 ~v v v v v v v w w N j t * U 4 O z , E e { } | $ M u F s 8 / G H ; h 7 & 1 x W = # L f r - Y D 9 q a ' 2 I b w B [ i K ! " c 6 + v @ J 5 g p n R Z _ % C l ( ? S : V X m 0 ` A d 3 > y o \ Q ^ . k ) ~ P ] < T The file is already fully retrieved; nothing to do. %*s[ skipping %dK ] CTRL+Break received, redirecting output to `%s'. Execution continued in background. You may stop Wget by pressing CTRL+ALT+DELETE. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. FINISHED --%s-- Downloaded: %s bytes in %d files Mandatory arguments to long options are mandatory for short options too. Originally written by Hrvoje Niksic . REST failed, starting from scratch. REST failed; will not truncate `%s'. (%s bytes) (%s to go) (unauthoritative) [%s to go] [following] %d redirections exceeded. %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld] %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - `%s' saved [%ld] %s ERROR %d: %s. %s received, redirecting output to `%%s'. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Cannot convert `%s' to an IP address. %s: %s: Invalid progress type `%s'. %s: %s: Invalid specification `%s'. %s: %s: Not enough memory. %s: %s: Please specify always, on, off, or never. %s: %s: Please specify on or off. %s: %s: invalid command %s: %s:%d: unknown token "%s" %s: %s:%d: warning: "%s" token appears before any machine name %s: BUG: unknown command `%s', value `%s'. %s: Cannot read %s (%s). %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid specification `%s' %s: Redirection cycle detected. %s: Warning: Both system and user wgetrc point to `%s'. %s: cannot stat %s: %s %s: corrupt time-stamp. %s: debug support not compiled in. %s: illegal option -- %c %s: illegal option -- `-n%c' %s: missing URL %s: option `%c%s' doesn't allow an argument %s: option `%s' is ambiguous %s: option `%s' requires an argument %s: option `--%s' doesn't allow an argument %s: option requires an argument -- %c %s: unknown/unsupported file type. %s: unrecognized option `%c%s' %s: unrecognized option `--%s' (no description) (try:%2d) ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot initiate PASV transfer. Cannot open cookies file `%s': %s Cannot parse PASV response. Cannot write to `%s' (%s). Connecting to %s:%hu... Connecting to %s[%s]:%hu... Continuing in background. Control connection closed. Converted %d files in %.2f seconds. Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. Could not find proxy host. Could not seed OpenSSL PRNG; disabling SSL. Creating symlink %s -> %s Data transfer aborted. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. Directory Download quota (%s bytes) EXCEEDED! Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --limit-rate=RATE limit download rate to RATE. ERROR: Redirection (%d) without location. End of file while parsing headers. Error closing `%s': %s Error in Set-Cookie, field `%s' Error in proxy URL %s: Must be HTTP. Error in server greeting. Error in server response, closing control connection. Error parsing proxy URL %s: %s. Error writing to `%s': %s FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Failed to get certificate key from %s Failed to load certificates from %s Failed to set up an SSL context Failed to unlink symlink `%s': %s Failed writing HTTP request: %s. File File `%s' already there, not retrieving. File `%s' already there, will not retrieve. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. Host not found Index of /%s on %s:%d Invalid PORT. Invalid dot style specification `%s'; leaving unchanged. Invalid name of the symlink, skipping. Last-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %s Link Loading robots.txt; please ignore errors. Location: %s%s Logged in! Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status line No URLs found in %s. No data received No matches on pattern `%s'. No such directory `%s'. No such file `%s'. No such file or directory `%s'. Not descending to `%s' as it is excluded/not-included. Not sure Output will be written to `%s'. Read error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Rejecting `%s'. Remote file is newer than local file `%s' -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file `%s' -- not retrieving. Removed `%s'. Removing %s since it should be rejected. Removing %s. Resolving %s... Retrying. Reusing connection to %s:%hu. Server error, can't determine system type. Server file no newer than local file `%s' -- not retrieving. Skipping directory `%s'. Starting WinHelp %s Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Symlinks not supported, skipping symlink `%s'. Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. The server refuses login. The sizes do not match (local %ld) -- retrieving. The sizes do not match (local %ld) -- retrieving. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Try `%s --help' for more options. Trying without the specified certificate Unable to delete `%s': %s Unable to establish SSL connection. Unknown authentication scheme. Unknown error Unknown type `%c', closing control connection. Unsupported listing type, trying Unix listing parser. Usage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using `%s' as listing tmp file. Warning: wildcards not supported in HTTP. Will not retrieve dirs since depth is %d (max %d). Write failed, closing control connection. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. connected. couldn't connect to %s:%hu: %s done. done. done. failed: %s. ignored nothing to do. time unknown unspecified Project-Id-Version: wget 1.8 POT-Creation-Date: 2001-12-08 23:28+0100 PO-Revision-Date: 2001-12-10 21:10+0200 Last-Translator: Jochen Hein Language-Team: German MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8-bit Download der Datei schon vollstndig; kein Download notwendig. %*s[ berspringe %dK ] CTRL+Break (= Strg+Untbr) empfangen, Ausgabe wird nach %s umgeleitet. Ausfhrung wird im Hintergrund fortgefhrt. Wget kann durch das Drcken von CTRL+ALT+DELETE (= Strg+Alt+Entf) gestoppt werden. Die Fortfhrung des Downloads ist fehlgeschlagen; dies ist ein Widerspruch zur Option -c. Die vorhandene Datei %s wird nicht abgeschnitten. BEENDET --%s-- Geholt: %s Bytes in %d Dateien Erforderliche Argumente zu langen Optionen sind auch bei kurzen Optionen erforderlich. Ursprnglich geschrieben von Hrvoje Niksic . REST schlug fehl; es wird wieder von vorn begonnen. REST schlug fehl; %s wird nicht abgeschnitten. (%s Bytes) (noch %s) (unmageblich) [noch %s] [folge] %d: Die Anzahl der Verweise ist zu gro. %s (%s) - Verbindung bei Byte %ld geschlossen. %s (%s) - Verbindung bei Byte %ld/%ld geschlossen. %s (%s) - Daten-Verbindung: %s; %s (%s) - Lesefehler bei Byte %ld (%s). %s (%s) - Lesefehler bei Byte %ld/%ld (%s). %s (%s) - %s gespeichert [%ld/%ld] %s (%s) - %s gespeichert [%ld/%ld]) %s (%s) - %s gespeichert [%ld] %s FEHLER %d: %s. %s erhalten, Ausgabe nach %%s umleiten. %s Anforderung gesendet, warte auf Antwort... %s: %s; Kontroll-Verbindung schlieen. %s: %s: %s ist nicht in eine IP-Adresse umwandelbar. %s: %s: Ungltiger Fortschrittstyp %s. %s: %s: Ungltige Angabe %s %s: %s: Nicht gengend Speicher. %s: %s: Bitte on, off oder never angeben. %s: %s: Bitte on oder off angeben. %s: %s: ungltiger Befehl %s: %s:%d: unbekannter Wortteil %s %s: %s:%d: Warnung: %s-Wortteil erscheint vor einem Maschinennamen %s: Unbekannter Befehl %s, Wert %s. %s: %s nicht lesbar (%s). %s: Kein benutzbar "socket driver" auffindbar. %s: Fehler in %s bei Zeile %d. %s: Ungltige Angabe %s %s: Zyklischer Verweis festgestellt. %s: Warnung: wgetrc des Systems und des Benutzers zeigen nach %s. %s: kann nicht finden %s: %s %s: beschdigter Zeitstempel. %s: Debug-Untersttzung nicht einkompiliert. %s: ungltige Option -- %c %s: ungltige Option -- -n%c %s: URL fehlt %s: Option %c%s erlaubt kein Argument %s: Option %s ist zweideutig %s: Option %s bentigt ein Argument %s: Option --%s erlaubt kein Argument %s: Option verlangt ein Argument -- %c %s: unbekannter bzw. nicht untersttzter Dateityp. %s: nicht erkannte Option %c%s %s: nicht erkannte Option --%s (keine Beschreibung) (Versuch:%2d) ==> CWD nicht notwendig. ==> CWD nicht erforderlich. Der richtige symbolische Verweis %s -> %s ist schon vorhanden. Authorisierung fehlgeschlagen. Verbindungsfehler (%s). Ausfhrliche und keine Meldungen ist gleichzeitig unmglich. Zeitstempel und berschreibung alter Dateien ist gleichzeitig unmglich. Anlegen eines Backups von %s als %s nicht mglich: %s Verweise nicht umwandelbar in %s: %s Kann PASV-bertragung nicht beginnen. Cookie-Datei %s kann nicht geffnet werden: %s Kann PASV-Antwort nicht auswerten. Kann nicht nach %s schreiben (%s). Verbindungsaufbau zu %s:%hu... Verbindungsaufbau zu %s[%s]:%hu... Im Hintergrund geht's weiter. Kontroll-Verbindung geschlossen. %d Dateien in %.2f Sekunden konvertiert. Umwandlung von %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. Proxy-Host nicht auffindbar. SSL deaktiviert, weil der Zufallszahlengenerator nicht initialisiert werden konnte. Symbolischen Verweis %s -> %s anlegen. Daten-bertragung abgebrochen. Verzeichnisse: -nd --no-directories keine Verzeichnisse anlegen -x, --force-directories Anlegen von Verzeichnissen erwingen -nH, --no-host-directories keine Host-Verzeichnisse anlegen -P, --directory-prefix=PREFIX Dateien unter dem Verzeichnis PREFIX/... speichern --cut-dirs=ZAHL ZAHL der Verzeichnisebenen der Gegenseite berspringen Verzeichnis Download-Kontingent (%s Bytes) ERSCHPFT! Download: --bind-address=ADRESSE fr den lokalen Rechner ADRESSE (Hostname oder IP) vorgeben -t, --tries=ZAHL Anzahl der Wiederholversuche auf ZAHL setzen (0 steht fr unbegrenzt) -O --output-document=DATEI Dokumente in DATEI schreiben -nc, --no-clobber bestehende Dateien nicht berschreiben oder .# Suffix verwenden -c, --continue Fortfhrung des Downloads einer bereits zum Teil geholten Datei --progress=STYLE Anzeige fr den Download auf STYLE setzen -N, --timestamping Nur Dateien holen, die neuer als die lokalen Dateien sind -S, --server-response Antwort des Servers anzeigen --spider kein Download (don't download anything) -T, --timeout=SEKUNDEN den Lese-Timeout auf SEKUNDEN setzen -w, --wait=SEKUNDEN SEKUNDEN zwischen den Downloads warten --waitretry=SEKUNDEN 1...SEKUNDEN zwischen den erneuten Versuchen warten --random-wait Zwischen 0 und 2*WAIT Sekunden zwischen Versuchen warten -Y, --proxy=on/off Proxy ein (on) oder aus (off) stellen -Q, --quota=ZAHL Kontingent fr den Download auf ZAHL setzen --limit-rate=RATE Datenrate beim Download auf RATE begrenzen FEHLER: Umleitung (%d) ohne Ziel(?). Dateiende beim Auswerten des Vorspanns (headers). Fehler beim Schlieen von %s: %s. Fehler bei Set-Cookie, Feld %s Fehler in der Proxy-URL %s: Es muss eine HTTP-URL sein. Fehler bei der Begrung des Servers. Fehler in der Antwort des Servers; schliee Kontroll-Verbindung. Fehler beim Parsen der Proxy-URL %s: %s. Fehler beim Schreiben nach %s: %s. FTP-Optionen: -nr, --dont-remove-listing .listing-Dateien nicht entfernen -g, --glob=on/off Dateinamen-Globbing ein- (on) oder ausstellen (off) --passive-ftp den "passiven" bertragungsmodus verwenden --retr-symlinks falls auftretend, verlinkte Dateien holen (keine Verzeichnisse) Fehlversuch den Zertifikat-Schlssel von %s zu erhalten. Fehler beim Laden der Zertifikate von %s Fehler beim Herstellen des SSL-Kontextes Entfernen des symbolischen Verweises %s fehlgeschlagen: %s Fehler beim Schreiben der HTTP-Anforderung: %s. Datei Die Datei %s ist schon vorhanden, kein erneuter Download. Datei %s ist schon vorhanden, kein erneuter Download. GNU Wget %s, ein nicht-interaktives Netz-Werkzeug zum Download von Dateien. Aufgegeben. HTTP-Optionen: --http-user=BENUTZER http-Benutzer auf BENUTZER setzen --http-passwd=PASS http-Passwort auf PASS setzen -C, --cache=on/off server-gepufferte Daten erlauben/verbieten (server-cached data) (normalerweise erlaubt) -E, --html-extension alle text/html-Dokumente mit dem Suffix .html speichern --ignore-length das Content-Length-Kopffeld ignorieren --header=ZEICHENKETTE ZEICHENKETTE zwischen die Kopfzeilen einfgen --proxy-user=BENUTZER BENUTZER als Proxy-Benutzername setzen --proxy-passwd=PASS PASS als Proxy-Passwort setzen --referer=URL die Kopfzeile `Referer: URL' der HTTP-Anforderung hinzufgen -s, --save-headers den HTTP-Vorspann (header lines) in Datei sichern -U, --user-agent=AGENT als AGENT anstelle of Wget/VERSION identifizieren --no-http-keep-alive HTTP keep-alive (ununterbrochene Verbindungen) deaktivieren --cookies=off Cookies nicht verwenden --load-cookies=DATEI Cookies vor der Sitzung aus der DATEI laden --save-cookies=DATEI Cookies nach der Sitzung in der DATEI speichern Host nicht gefunden Index von /%s auf %s:%d Ungltiger PORT. Ungltiger Stil fr den Fortschrittsindikator %s; keine nderung. Ungltiger Name fr einen symbolischen Verweis; bersprungen. Last-modified-Kopfzeile ungltig -- Zeitstempel bergangen. Last-modified-Kopfzeile fehlt -- Zeitstempel abgeschaltet. Lnge: Lnge: %s Verweis Lade robots.txt; bitte Fehler ignorieren. Platz: %s%s Angemeldet! Log-Datei schreiben und Eingabe-Datei: -o, --output-file=DATEI Protokoll-Meldungen in DATEI schreiben -a, --append-output=DATEI Meldungen der DATEI anhngen -d, --debug Debug-Ausgabe anzeigen -q, --quiet keine Ausgabe von Meldungen -v, --verbose ausfhrliche Meldungen (Vorgabe) -nv, --non-verbose Meldungen weniger ausfhrlich, aber nicht --quiet -i, --input-file=DATEI in DATEI gelistete URLs holen -F, --force-html Eingabe-Datei als HTML behandeln -B, --base=URL URL relativen Links in -F -i DATEI voranstellen --sslcertfile=DATEI optionales Client-Zertifikat. --sslcertkey=SCHLSSEL_DATEI optionale SCHLSSEL_DATEI fr dieses Zertifikat. --egd-file=FILE Dateiname des EGD Sockets. Anmelden als %s ... Fehler bei der Anmeldung. Fehlerberichte und Verbesserungsvorschlge bitte an schicken. Fr die deutsche bersetzung ist die Mailingliste zustndig. Nicht korrekte Statuszeile Keine URLs in %s gefunden. Keine Daten empfangen Keine Treffer bei dem Muster %s. Das Verzeichnis %s gibt es nicht. Die Datei %s gibt es nicht. Die Datei oder das Verzeichnis %s gibt es nicht. Nicht zu %s hinabsteigen, da es ausgeschlossen bzw. nicht eingeschlossen ist. Nicht sicher Ausgabe wird nach %s geschrieben. Lesefehler (%s) beim Vorspann (header). Die Rekursionstiefe %d bersteigt die max. erlaubte Tiefe %d. Rekursiv erlauben/zurckweisen: -A, --accept=LISTE komma-unterteilte Liste der erlaubten Dateiendungen -R, --reject=LISTE komma-unterteilte Liste der zurckzuweisenden Erweiterungen -D, --domains=LISTE komma-unterteilte Liste der erlaubten Domains --exclude-domains=LISTE komma-unterteilte Liste der zurckzuweisenden Domains --follow-ftp FTP-Verweisen von HTML-Dokumenten aus folgen --follow-tags=LISTE komma-unterteilte Liste der zu folgenden HTML-Tags -G, --ignore-tags=LISTE komma-unterteilte Liste der zu missachtenden HTML-Tags -H, --span-hosts wenn --recursive, auch zu fremden Hosts gehen -L, --relative nur relativen Verweisen folgen -I, --include-directories=LISTE Liste der erlaubten Verzeichnisse -X, --exclude-directories=LISTE Liste der auszuschlieenden Verzeichnisse -np, --no-parent nicht in das bergeordnete Verzeichnis wechseln Rekursives Holen: -r, --recursive rekursiver Download -- mit Umsicht verwenden! -l, --level=Zahl maximale Rekursionstiefe (inf oder 0 steht fr ohne Begrenzung) --delete-after geholte Dateien nach dem Download lschen -k, --convert-links nicht-relative Links in relative umwandeln -K, --backup-converted vor dem Umwandeln der Datei X, ein Backup als X.orig anlagen. -m, --mirror Kurzform, die -r -N -l inf -nr entspricht. -p, --page-requisites alle Bilder usw. holen, die fr die Anzeige der HTML-Seite notwendig sind %s zurckgewiesen. Datei auf dem Server neuer als die lokale Datei %s, -- erneuter Download. Datei der Gegenseite ist neuer, erneuter Download. Datei auf dem Server nicht neuer als die lokale Datei %s -- kein Download. %s gelscht. Entferne %s, da dies zurckgewiesen werden soll. Entferne %s. Auflsen des Hostnamen %s.... Erneuter Versuch. Weiterverwendung der Verbindung zu %s:%hu. Fehler beim Server; es ist nicht mglich, die Art des Systems festzustellen. Datei auf dem Server nicht neuer als die lokale Datei %s -- kein Download. Verzeichnis %s bersprungen. WinHelp %s wird gestartet Beim Start: -V, --version Programmversion anzeigen -h, --help diese Hilfe anzeigen -b, --background nach dem Starten in den Hintergrund gehen -e, --execute=BEFEHL einen .wgetrc-artigen Befehl ausfhren Symbolischer Verweis nicht mglich; symbolischer Verweis %s bersprungen. Syntaxfehler bei Set-Cookie beim Zeichen %c. Syntaxfehler bei Set-Cookie, Zeichenkette vorzeitig zu Ende. Der Server verweigert die Anmeldung. Gren stimmen nicht berein (lokal %ld) -- erneuter Download. Gren stimmen nicht berein (lokal %ld) -- erneuter Download. Dieses Programm wird in der Hoffnung verteilt, dass es ntzlich ist. Es gibt KEINERLEI Garantie, nicht einmal fr die TAUGLICHKEIT oder die VERWENDBARKEIT ZU EINEM ANGEGEBENEN ZWECK. In den Quellen befindet sich die Lizenz- und Kopierbedingung; die Einzelheiten sind in der Datei COPYING (GNU General Public License) beschrieben. %s --help gibt weitere Informationen. Versuch ohne die angegebenen Zertifikate Es ist nicht mglich, %s zu lschen: %s Es ist nicht mglich, eine SSL-Verbindung herzustellen. Unbekanntes Authentifizierungsschema. Unbekannter Fehler Unbekannte Art %c, schliee Kontroll-Verbindung. Nicht untersttzte Art der Auflistung; Versuch Unix-Auflistung zu verwenden. Syntax: %s NETRC [HOSTNAME] Syntax: %s [OPTION]... [URL]... %s als temporre Auflistungsdatei benutzen. Warnung: Joker-Zeichen werden bei HTTP nicht untersttzt. Verzeichnisse nicht erneut holen; da die Tiefe bereits %d ist (max. erlaubt %d). Schreiben schlug fehl; Kontroll-Verbindung schlieen. HTML-artigen Index nach %s [%ld] schreiben. HTML-artiger Index nach %s geschrieben. verbunden. Konnte keine Verbindung zu %s:%hu herstellen: %s fertig. fertig. fertig. fehlgeschlagen: %s. bergangen kein Download notwendig. Zeit unbekannt nicht spezifiziert ntfernen des symbolischen Verweises %s fehlgeschlagen: %s Fehler beim Schreiben der HTTP-Anforderung: %s. Datei Die Datei %s ist schon vorhanden, kein erneuter Download. Datei %s ist schon v./share/locale/el/ 755 0 0 0 7445172715 7032 ./share/locale/el/LC_MESSAGES/ 755 0 0 0 7445172715 10617 ./share/locale/el/LC_MESSAGES/wget.mo 644 0 0 34766 7445172715 12247 | 2 j K % ' ; G ) T - ~ & + ! @ b * & $ $ - " I l ? + / ( I r 8 0 5 O A p # & @ ^ , o % , & # 4 X x ' - 0 < ^ - L g Y > $ K * p # 6 " 4 ) A , k 2 ' F 4 a 8 * + 7 M 8 _ ! ! 7 C { + " ? ) N x / " / O / ] * 3 2 f * % $ 8 D D ! ! 6 ;" b r" 3 " # # '# 5# E# , R# 0 # ! # - # 2 $ ' 3$ ( [$ # $ $ , $ / $ # % <% " ]% " % % $ % X % $ ;& 9 `& & - & ! & ' Z (' J ' J ' ) ( V C( ' ( " ( " ( H ) Q) " p) ) + ) ! ) " ) + * * H* - s* # * # * * * + $+ . =+ l+ + ; + i + * H, 3 s, 1 , % , , ! - 7- Q- m- $ - % - ( - x - o/ M |/ ( / 5 / , )0 A V0 1 0 0 - 0 0 1 D 61 {1 1 1 1 1 5 1 $2 I C2 K 2 2 2 2 F 2 ?3 P3 c3 3 A 3 3 3 4 ) &4 $ P4 u4 & 4 J 4 5 5 95 & Z5 B 5 5 6 5 6 . #6 R6 d6 w6 6 E 6 & 6 ; 7 T7 u7 + 7 $ 7 $ 7 7 < 8 G X8 B 8 # 8 < 9 2 D9 , w9 9 9 9 9 9 9 9 R L w T d , = % e 8 p ! Q A f b y + z i 6 U v 9 0 n m ? a ` < N \ l S J j O - c ] " V @ { / g ( W u ' } 5 o H ^ ~ 7 Z 4 $ I q F 2 M * B D Y h x : | [ _ ; K > E & . X 3 r ) t P # s k C 1 G [ skipping %dK ] CTRL+Break received, redirecting output to `%s'. Execution continued in background. You may stop Wget by pressing CTRL+ALT+DELETE. FINISHED --%s-- Downloaded: %s bytes in %d files Mandatory arguments to long options are mandatory for short options too. REST failed, starting from scratch. (%s bytes) (%s to go) (unauthoritative) [%s to go] [following] %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld] %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - `%s' saved [%ld] %s ERROR %d: %s. %s received, redirecting output to `%%s'. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Invalid specification `%s'. %s: %s: Not enough memory. %s: %s: Please specify on or off. %s: %s: invalid command %s: %s:%d: unknown token "%s" %s: %s:%d: warning: "%s" token appears before any machine name %s: BUG: unknown command `%s', value `%s'. %s: Cannot determine user-id. %s: Cannot read %s (%s). %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid specification `%s' %s: Warning: Both system and user wgetrc point to `%s'. %s: Warning: cannot determine local IP address. %s: Warning: cannot reverse-lookup local IP address. %s: Warning: gethostname failed %s: Warning: reverse-lookup of local address did not yield FQDN! %s: Warning: uname failed: %s %s: cannot stat %s: %s %s: corrupt time-stamp. %s: debug support not compiled in. %s: illegal option -- %c %s: illegal option -- `-n%c' %s: missing URL %s: option `%c%s' doesn't allow an argument %s: option `%s' is ambiguous %s: option `%s' requires an argument %s: option `--%s' doesn't allow an argument %s: option requires an argument -- %c %s: unknown/unsupported file type. %s: unrecognized option `%c%s' %s: unrecognized option `--%s' (no description) (try:%2d) ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot convert links in %s: %s Cannot initiate PASV transfer. Cannot parse PASV response. Cannot write to `%s' (%s). Connecting to %s:%hu... Connection to %s:%hu refused. Continuing in background. Control connection closed. Converting %s... Could not find proxy host. Creating symlink %s -> %s Data transfer aborted. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. Directory Download quota (%s bytes) EXCEEDED! ERROR: Redirection (%d) without location. End of file while parsing headers. Error in server greeting. Error in server response, closing control connection. Failed to unlink symlink `%s': %s File File `%s' already there, not retrieving. File `%s' already there, will not retrieve. GNU Wget %s, a non-interactive network retriever. Giving up. Host not found Index of /%s on %s:%d Invalid PORT. Invalid host name Invalid name of the symlink, skipping. Invalid port specification Last-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %s Link Loading robots.txt; please ignore errors. Location: %s%s Logged in! Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status line No URLs found in %s. No data received No matches on pattern `%s'. No such directory `%s'. No such file `%s'. No such file or directory `%s'. Not descending to `%s' as it is excluded/not-included. Not sure Output will be written to `%s'. Proxy %s: Must be HTTP. Read error (%s) in headers. Recursion depth %d exceeded max. depth %d. Rejecting `%s'. Remote file is newer, retrieving. Removed `%s'. Removing %s since it should be rejected. Removing %s. Retrying. Skipping directory `%s'. Starting WinHelp %s Symlinks not supported, skipping symlink `%s'. The server refuses login. Try `%s --help' for more options. Unknown authentication scheme. Unknown error Unknown type `%c', closing control connection. Unknown/unsupported protocol Usage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using `%s' as listing tmp file. Warning: wildcards not supported in HTTP. Will not retrieve dirs since depth is %d (max %d). Will try connecting to %s:%hu. Write failed, closing control connection. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. connected! done. done. done. ignored time unknown unspecified Project-Id-Version: GNU Wget 1.7-dev POT-Creation-Date: 2001-02-23 13:23-0800 PO-Revision-Date: 1999-02-09 02:00+0000 Last-Translator: Simos KSenitellis Language-Team: Greek MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-7 Content-Transfer-Encoding: 8-bit [ %dK ] CTRL+Break , `%s'. . Wget CTRL+ALT+DELETE. --%s-- : %s bytes %d . REST, . (%s bytes) (%s ) () [%s ] [] %s (%s) - byte %ld. %s (%s) - byte %ld/%ld. %s (%s) - : %s; %s (%s) - byte %ld (%s). %s (%s) - byte %ld/%ld (%s). %s (%s) - `%s' [%ld/%ld] %s (%s) - `%s' [%ld/%ld]) %s (%s) - `%s' [%ld] %s %d: %s. %s , `%%s'. %s , ... %s: %s, . %s: %s: `%s'. %s: %s: . %s: %s: on off. %s: %s: %s: %s:%d: "%s" %s: %s:%d: : "%s" %s: `%s', `%s'. %s: . %s: %s (%s). %s: . %s: %s %d. %s: `%s'. %s: : wgetrc `%s'. %s: : IP. %s: : IP. %s: : gethostname %s: : FDQN! %s: : uname : %s %s: %s: %s %s: . %s: . %s: -- %c %s: -- `-n%c' %s: URL %s: `%c%s' %s: `%s' %s: `%s' %s: `--%s' %s: -- %c %s: / . %s: `%c%s' %s: `--%s' ( ) (:%2d) ==> CWD . ==> CWD . %s -> %s . (%s). . . %s: %s PASV. PASV. `%s' (%s). %s:%hu... %s:%hu . . . %s... proxy. %s -> %s . : -nd --no-directories . -x, --force-directories . -nH, --no-host-directories host directories. -P, --directory-prefix= /... --cut-dirs= (%s bytes) ! : (%d) . . . , . `%s': %s `%s' , . `%s' , . GNU Wget %s, - . . /%s %s:%d PORT. , . (port) Last-modified -- . Last-modified -- . : : %s robots.txt; . : %s%s ! %s ... . . URL %s. `%s'. `%s'. `%s'. `%s'. `%s' /- `%s'. Proxy %s: HTTP. (%s) . %d %d. `%s'. , . `%s'. %s . %s. . `%s'. WinHelp %s , `%s'. . `%s --help' . . `%c', . / : %s NETRC [ ] : %s []... [URL]... `%s' . : (wildcards) HTTP. %d ( %d). %s:%hu. , . HTML `%s' [%ld]. HTML `%s'. ! . . . %s:%d Inv./share/locale/es/ 755 0 0 0 7445172716 7042 ./share/locale/es/LC_MESSAGES/ 755 0 0 0 7445172716 10627 ./share/locale/es/LC_MESSAGES/wget.mo 644 0 0 72250 7445172717 12246 : n 2 K @ > % & $ 0 D P ] ) x - & + C ! d * & $ . , $ [ $ 2 " 0 ? O + ( ; 8 \ # " , 3 ` % ~ , & # < \ m w ' - < " _ | " 1 N i $ P , ) V q Y $ O * e! # ! ! ! % ! " 6 -" d" " " & # $ # $ " +$ ! N$ p$ ) }$ , $ 2 $ % % ( ) ) 9 *) ' d) 4 ) 8 ) ) * * * * F* V* b* M- c- 8 u- - - - - . ". ! 7. 7 Y. . . . + . / 2 4 : 4 " 5 = #5 a5 ) p5 5 5 5 5 + 5 > 6 O6 i6 ~6 / o7 . 7 5 7 8 2 8 3 R8 8 " q9 ) 9 9 $ 9 9 : / ,: 6 \: : : : * : 3 ; * O; % z; ; ; ; ; ; ; < < < *< >< K J< J = = = y > 5 > j 1? B ? = ? 3 @ Q@ ]@ o@ @ @ # @ + @ / @ ! A / BA 3 rA # A $ A A B - !B , OB ) |B 7 B ) B & C # /C 9 SC ) C C $ C P C / FD vD D D D ! D # E U @E , E E 8 E F 4F QF 0 cF F ) F 0 F * G . 9G hG G G G G G 3 G /H ! GH D iH P H : H 1 :I ) lI 0 I ' I " I J ,J JJ iJ * J J P J , K = DK " K K K UM ( bM M * SS 5 ~S S ) S - S ! %T E GT * T T T 3 V / V & W 6 8W % oW W - W - W 4 W 3X BX ] "] 9] L K] 7 ] K ] G ^ d^ o^ |^ 3 ^ ^ ^ { ^ Wb tb D b b ! b c * /c Zc zc ) c ; c c d ( +d 7 Td j d h k L k ) k S l kl 0 |l l l l % l > m Z Em m m m E n : o ? Po $ o 4 o 7 o "p 7 q - Rq q ' q ' q q 8 q Q 5r + r ( r . r + s H 7s 5 s , s & s t # t :t Bt Kt Ut at lt t t N j t * U 4 O z , E e { } | $ M u F s 8 / G H ; h 7 & 1 x W = # L f r - Y D 9 q a ' 2 I b w B [ i K ! " c 6 + v @ J 5 g p n R Z _ % C l ( ? S : V X m 0 ` A d 3 > y o \ Q ^ . k ) ~ P ] < T The file is already fully retrieved; nothing to do. %*s[ skipping %dK ] CTRL+Break received, redirecting output to `%s'. Execution continued in background. You may stop Wget by pressing CTRL+ALT+DELETE. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. FINISHED --%s-- Downloaded: %s bytes in %d files Mandatory arguments to long options are mandatory for short options too. Originally written by Hrvoje Niksic . REST failed, starting from scratch. REST failed; will not truncate `%s'. (%s bytes) (%s to go) (unauthoritative) [%s to go] [following] %d redirections exceeded. %s (%s) - Connection closed at byte %ld. %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %ld (%s). %s (%s) - Read error at byte %ld/%ld (%s). %s (%s) - `%s' saved [%ld/%ld] %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - `%s' saved [%ld] %s ERROR %d: %s. %s received, redirecting output to `%%s'. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Cannot convert `%s' to an IP address. %s: %s: Invalid progress type `%s'. %s: %s: Invalid specification `%s'. %s: %s: Not enough memory. %s: %s: Please specify always, on, off, or never. %s: %s: Please specify on or off. %s: %s: invalid command %s: %s:%d: unknown token "%s" %s: %s:%d: warning: "%s" token appears before any machine name %s: BUG: unknown command `%s', value `%s'. %s: Cannot read %s (%s). %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid specification `%s' %s: Redirection cycle detected. %s: Warning: Both system and user wgetrc point to `%s'. %s: cannot stat %s: %s %s: corrupt time-stamp. %s: debug support not compiled in. %s: illegal option -- %c %s: illegal option -- `-n%c' %s: missing URL %s: option `%c%s' doesn't allow an argument %s: option `%s' is ambiguous %s: option `%s' requires an argument %s: option `--%s' doesn't allow an argument %s: option requires an argument -- %c %s: unknown/unsupported file type. %s: unrecognized option `%c%s' %s: unrecognized option `--%s' (no description) (try:%2d) ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot initiate PASV transfer. Cannot open cookies file `%s': %s Cannot parse PASV response. Cannot write to `%s' (%s). Connecting to %s:%hu... Connecting to %s[%s]:%hu... Continuing in background. Control connection closed. Converted %d files in %.2f seconds. Converting %s... Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. Could not find proxy host. Could not seed OpenSSL PRNG; disabling SSL. Creating symlink %s -> %s Data transfer aborted. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. Directory Download quota (%s bytes) EXCEEDED! Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --limit-rate=RATE limit download rate to RATE. ERROR: Redirection (%d) without location. End of file while parsing headers. Error closing `%s': %s Error in Set-Cookie, field `%s' Error in proxy URL %s: Must be HTTP. Error in server greeting. Error in server response, closing control connection. Error parsing proxy URL %s: %s. Error writing to `%s': %s FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Failed to get certificate key from %s Failed to load certificates from %s Failed to set up an SSL context Failed to unlink symlink `%s': %s Failed writing HTTP request: %s. File File `%s' already there, not retrieving. File `%s' already there, will not retrieve. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. Host not found Index of /%s on %s:%d Invalid PORT. Invalid dot style specification `%s'; leaving unchanged. Invalid name of the symlink, skipping. Last-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %s Link Loading robots.txt; please ignore errors. Location: %s%s Logged in! Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status line No URLs found in %s. No data received No matches on pattern `%s'. No such directory `%s'. No such file `%s'. No such file or directory `%s'. Not descending to `%s' as it is excluded/not-included. Not sure Output will be written to `%s'. Read error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Rejecting `%s'. Remote file is newer than local file `%s' -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file `%s' -- not retrieving. Removed `%s'. Removing %s since it should be rejected. Removing %s. Resolving %s... Retrying. Reusing connection to %s:%hu. Server error, can't determine system type. Server file no newer than local file `%s' -- not retrieving. Skipping directory `%s'. Starting WinHelp %s Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Symlinks not supported, skipping symlink `%s'. Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. The server refuses login. The sizes do not match (local %ld) -- retrieving. The sizes do not match (local %ld) -- retrieving. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Try `%s --help' for more options. Trying without the specified certificate Unable to delete `%s': %s Unable to establish SSL connection. Unknown authentication scheme. Unknown error Unknown type `%c', closing control connection. Unsupported listing type, trying Unix listing parser. Usage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using `%s' as listing tmp file. Warning: wildcards not supported in HTTP. Will not retrieve dirs since depth is %d (max %d). Write failed, closing control connection. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. connected. couldn't connect to %s:%hu: %s done. done. done. failed: %s. ignored nothing to do. time unknown unspecified Project-Id-Version: wget 1.8 POT-Creation-Date: 2001-12-08 23:28+0100 PO-Revision-Date: 2001-12-10 19:39GMT+0200 Last-Translator: Salvador Gimeno Zann](http://www.server.com/foo/bar.gif){kind=link}